KEGG   Aspergillus flavus: AFLA_070170Help
Entry
AFLA_070170       CDS       T01090                                 

Definition
(RefSeq) lysosomal alpha-glucosidase, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
afv  Aspergillus flavus
Pathway
afv00052  Galactose metabolism
afv00500  Starch and sucrose metabolism
afv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AFLA_070170
   00500 Starch and sucrose metabolism
    AFLA_070170
Enzymes [BR:afv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     AFLA_070170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 7914182
NCBI-ProteinID: XP_002380576
UniProt: B8NIY9
LinkDB All DBs
Position
Unknown
AA seq 950 aa AA seqDB search
MHLKKLLTSAAALSGSVFAQSKDGVEDLDGPGDDLYVKDLSGCPGYKATKHWQTRSGFYA
DLTLAGPACNVFGTDLPDLKLEVEYQTSDRLHVKILDTNNTVYQVPDSVFPRPGFGEWCS
PKDSKLKFDFQADPFSFTVSRTDTGEVLFDTTGNKLVFESQYVYLKTHLPQNPHLYGLGE
HSDAFMLNTTNYTRTIYTRDAYGTPQGENLYGAHPIYFDHRQTGTHGVFLLNSNGMDIFI
DNNSTQFLEYNIIGGVLDFYFIAGPTPRDVAIQYAEITQTPLMTPYWGLGYHQCKYGYQD
VYEVAAVVANYSTNNIPLETIWTDIDYMDRRRIFTIDPERFPADLYKDLVDTIHARDQHY
IVMVDPAVYYKESNPALDEGLKYDIFMKENNGSEYQGVVWAGPSHFPDWFHPDSQQYWSE
QFLAFFDGTNGPDIDALWIDMNEPANFYNRPYPGNNTTPENFAEVDGDPPAAPAVRDGPD
APIPGFPASLQPNWVQGNATEKRSTAAVVKRQRSQSRRNLGAGHWKSPKGKFDARAGWQH
GKQTGSGCGPNECKGLPNRHLIRPPYMIQNGAGPTLADSTADTDLVQSGGYVQYDTHNLY
GAMMSSHSHNAMRARRPDDRALVITRSTFAGSGKDVSHWLGDNVSGWLWYQLSISQILQF
ASLYQIPVVGPDVCGFGGNVTETLCARWATLGSFYTFFRNHAEIYANSQEFYRWPTVAQA
ARNGISIRYQLLDYIYTAIYKQNQTGTPALNPLFFNYPNDPNTYPIDLQFFYGDGILVSP
VTEENSTSVTFYLPDDIFYEWGTGKPVRGQGEYVSLDNIDYTDITIHYKGGIVYPQRIES
ANTTTALRQKGFNIVVAPGLDGRAEGSLYLDDGVSVVQDTVSEIDFVYENGKLTMSGSFE
YDAGVGIETITVLGVESKPEGDDVEYDAENKKLVKHVDVPLTGEDEITIL
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttaagaagctgctgacctcggctgcagccctcagtggctccgtctttgcccag
agcaaggatggcgtggaggatctcgatggccccggcgatgacctatacgtgaaggatctt
tctggatgcccgggatacaaggccaccaagcactggcagactcggtctggcttttatgcg
gacctgactctcgcaggtccggcatgcaacgtcttcggcactgatctcccggacttgaag
ctcgaagtcgagtatcagaccagcgatcgactccacgtcaagatcttggacaccaacaac
actgtctaccaggttccagacagtgtcttcccgcgtccgggatttggcgaatggtgctcc
ccgaaggacagcaagctcaagtttgacttccaggccgaccccttctcgttcacggtgtct
cgaactgataccggtgaagtgctcttcgacaccaccggcaacaagctggtgttcgagagc
caatatgtctacctgaagacacaccttccgcagaacccgcatctgtacggtctgggtgag
cacagtgatgcattcatgctcaacacgaccaactacacccggaccatctacacccgtgat
gcttacggaacaccccaaggcgagaacctgtacggtgctcatccgatctactttgaccac
aggcagaccgggactcacggagtgttcctgctcaactctaacggaatggatatcttcatc
gacaacaactccacccagttccttgagtacaacatcattggcggtgttcttgatttctac
tttattgccggacctaccccacgtgacgtggccatccagtacgctgaaatcactcagacc
ccgttgatgactccttattggggacttggttaccaccaatgcaagtacggctaccaagac
gtctacgaggttgccgctgtcgtcgccaactactccaccaacaacattcctctcgagacg
atctggactgatatcgactacatggaccgtcgtcgcatcttcaccattgacccagaacgg
ttcccggccgatctgtacaaagaccttgtggacaccatccatgcgagggaccagcattac
atcgtcatggtcgatcccgccgtgtattacaaggagtctaacccggcgcttgatgaaggt
ctcaaatatgacattttcatgaaggagaacaatggctctgaatatcagggtgtcgtctgg
gctggcccgagtcacttcccggattggttccaccctgactctcagcagtactggagtgag
cagttcctggccttcttcgacggaaccaatggcccagacattgatgctctatggatcgac
atgaacgagcccgcaaacttctacaaccgcccataccctggcaacaacaccacccccgag
aacttcgccgaggtggatggtgaccctcccgcggcgccagcagtcagagacggccccgat
gctcctatccctggattcccggccagccttcaaccaaactgggttcagggcaacgcgact
gaaaagcgctcaactgctgctgttgtcaaacgtcaacgctcgcagtcccgccgcaacctc
ggcgccggtcactggaagtcccccaagggcaagttcgacgcgcgtgctggctggcaacac
ggcaaacagaccggttctggttgtggccccaacgagtgcaagggtcttcccaaccgtcat
ctcatcaggccgccgtacatgatccagaacggcgccggtcccacgcttgccgacagcact
gccgacacggatctggtgcagagtggtggatacgtccagtatgatacccacaacctttac
ggcgctatgatgtcctcgcattcccataatgctatgcgcgccaggcgtccggatgatcgg
gctttggtcattaccaggagcacctttgctggctctggaaaggatgtgtcccactggcta
ggagataatgtatccggctggctttggtaccagctctcgatcagccagatcctgcagttc
gcgtccttgtaccagatccccgttgtgggtcctgacgtttgtggcttcggtggtaatgtc
acggagacactctgtgccagatgggcaaccctcggctccttctacacattcttccgcaac
cacgccgagatctacgcgaactcgcaagaattctaccgctggcccacagtagctcaagcc
gctcgcaacggaatctccatcagataccagctcctggactacatctacacagccatctac
aaacagaaccaaaccggtacacctgccctaaaccccctgttcttcaactaccccaacgac
cccaacacctaccccatcgacctccaattcttctacggagacggcatcctcgtttccccc
gtcacagaagaaaacagcacaagcgtcaccttctacctccccgacgacatcttctacgaa
tggggcaccggcaagcccgtccgcggccagggtgaatacgtctccctcgataatatcgac
tacacggacatcaccatccactataagggtggtatcgtctatccccagcgtatcgagagc
gcaaacaccaccaccgctttacggcagaagggtttcaacattgttgttgcaccaggcttg
gatggtcgtgctgagggttcgctttatcttgatgatggagtgtcggttgtgcaggatact
gtgtctgagattgactttgtctatgagaatggcaagcttaccatgagtggctcgtttgag
tatgatgctggggttggtattgagactatcactgttttgggtgtggagagtaagcccgag
ggtgatgatgtggagtatgatgcggagaataagaagttggtcaagcatgttgatgtgcct
ttgacgggtgaggatgagattacgattttgtga

DBGET integrated database retrieval system