KEGG   Aspergillus flavus: AFLA_086400Help
Entry
AFLA_086400       CDS       T01090                                 

Definition
(RefSeq) isocitrate dehydrogenase Idp1, putative
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
afv  Aspergillus flavus
Pathway
afv00020  Citrate cycle (TCA cycle)
afv00480  Glutathione metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
afv01200  Carbon metabolism
afv01210  2-Oxocarboxylic acid metabolism
afv01230  Biosynthesis of amino acids
afv04146  Peroxisome
Module
afv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFLA_086400
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFLA_086400
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AFLA_086400
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AFLA_086400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 7909786
NCBI-ProteinID: XP_002373554
UniProt: B8N000
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MMNSLRLHSASVRRAVASPLSAPLSSSAYRSISCTSSSYISSSSSSSFSTAATPRAQRPL
ASSQLPRIVSPRQTGIYPLQWTQARTMATEGPKIKVKNPVVELDGDEMTRIIWQEIREKL
ILPYLDIDLKYYDLGLEYRDQTDDQVTVEAAEAIKKYGVGVKCATITPDEARVEEFKLKK
MWLSPNGTIRNILGGTVFREPIIIPRVPRLVPGWTKPIIIGRHAFGDQYRATDRVIPGPG
KLELVYTPVNGEPETVKVYDFQGGGVTQTQYNTDESIQGFAHASFQMALLKGLPLYMSTK
NTILKKYDGRFKDIFQEIYESTYKKDFEAKNIWYEHRLIDDMVAQMIKSEGGFVMALKNY
DGDVQSDIVAQGFGSLGLMTSTLTTPSGEAFESEAAHGTVTRHYREHQKGRETSTNPIAS
IFAWTRGLVQRGKLDETPDVVAFAEELERACIEVVNDEGIMTKDLALACGRKDRDAWVTT
KEYMAAVERKLKTNLKSRL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattcccttcggctccattccgcgtcggttcgccgcgctgtcgcctcccctctg
tctgcccctctctcttcctccgcttatcgctcgatctcctgcacttcttcttcttacatt
tcctcttcgtcttcttcttctttctcgactgctgctacccctcgcgctcagagacccctc
gcttcgtctcagctccctcgtattgtctccccccgccagaccggaatctaccctttgcag
tggacacaggcccgcaccatggcaactgaaggccccaagatcaaggttaagaacccagtg
gtggaactggatggagatgagatgacccgtattatctggcaggagatcagagagaagttg
atcttgccttaccttgacattgacctcaagtactacgacctgggacttgaataccgtgac
cagaccgatgaccaggtcaccgtcgaggccgcggaggccatcaagaaatatggtgttggt
gtcaagtgtgctaccatcacccccgatgaagcccgtgttgaggagttcaagttgaagaag
atgtggctttctcccaacggaaccatcagaaacattctcggcggaactgtcttccgtgaa
cccatcatcattccccgcgttccccgtctcgtacctgggtggaccaagcctatcatcatt
ggacgtcacgccttcggtgaccagtaccgtgccactgaccgtgtgattcccggccccggc
aagcttgagcttgtctacacccctgtcaatggcgagcccgagaccgtcaaggtctacgac
ttccagggcggcggtgttactcagactcagtacaacactgatgagtccatccagggcttc
gcccacgccagtttccagatggccttgctgaagggtctgcctctgtacatgagcaccaag
aacaccattctgaagaagtacgatggtcgcttcaaggatatcttccaggagatctacgag
tccacctacaagaaggatttcgaggccaagaacatctggtatgagcaccgtctgatcgac
gatatggtcgctcagatgatcaagagcgagggtggcttcgttatggctcttaagaactac
gatggtgatgttcagtcggacatcgtcgcccagggtttcggttctctgggtctgatgacc
tctaccctcaccacccccagcggtgaggccttcgagtctgaagccgctcacggtaccgtg
acccgtcactaccgtgagcaccagaagggccgtgagacctccaccaaccccattgcctcc
atctttgcctggacccgtggtctggtgcagcgtggcaagctcgacgagacccccgacgtg
gttgctttcgccgaggagttggagcgtgcctgtatcgaagtcgtgaacgacgagggcatc
atgaccaaggacttggctctcgcatgcggccgcaaggaccgtgacgcgtgggtcaccacc
aaggagtacatggcagctgttgagcggaagctgaagaccaacctgaagtccagactgtaa

DBGET integrated database retrieval system