KEGG   Aspergillus flavus: AFLA_093060Help
Entry
AFLA_093060       CDS       T01090                                 

Definition
(RefSeq) DNA ligase, putative
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
afv  Aspergillus flavus
Pathway
afv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:afv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AFLA_093060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:afv03400]
    AFLA_093060
Enzymes [BR:afv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AFLA_093060
DNA repair and recombination proteins [BR:afv03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     AFLA_093060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 RNA_ligase DNA_ligase_A_C LIG3_BRCT BRCT DNA_ligase_IV mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 7913671
NCBI-ProteinID: XP_002381126
UniProt: B8NKQ2
LinkDB All DBs
Position
Unknown
AA seq 980 aa AA seqDB search
MDSDDDYNGPADTNPRLEDEESDLDENEIKKKPAGPARKKVGPHGLSSVNLTPLEKRRDI
IDRFISRWRKEVGDDIYPAFRLILPDKDRDRAMYGMKEKAIGKLLIRIMKIDKNSEDALN
LLNWKLPGQTTTSSMAGDFAGRCFGVLSKRPMRTEVGDMTIEEVNEKLDHLSAASKENQQ
LPILTEFYRRMNPEELMWLIRIILRQMKVGATERTFFDVFHPDAENLYSISSSLRRVCWE
LHDPNIRLEAEDRGITLMQCFQPQLAQFQMHSLDRMISRMRLTEDDPVFWIEEKLDGERM
QLHMDSNDSVPGGRTFRFWSRKAKDYTYLYGNGIQDENGALTRYLNDAFADGVESLILDG
EMITWDTEQDAIAPFGTLKTAALSEQRNPYSSTTRPLFRIFDILYLNGRDLTRYTLRDRR
NALQKSIKPVYRRFEIHPYEEATGKTEIEEALRRVVEEASEGLVLKNPRSPYRLNERHDD
WMKVKPEYMTEFGESLDVVVIGGYYGSGHRGGGLSSFLCGLRVDDAHSSQGMVASKCYSF
CKVGGGFTAADYANIRHHTDGKWHEWKSRKPPTTYIELAGGDAQYERPDMWIKPEDSVVL
CVKAASVAVSDQFRIGLTLRFPRFKKLRMDKDWKSALSVQEFLDLKANAERERKEKEFNV
DNSRKKRAKRDNKKPLAIAGYSAEAEAQYTGPSGNIFEGLNFYITTDSNTPVKKSKAELE
QLVKANGGKFFQTSNAAPSTICIADRRTVKAASLQKSGNVNIIRPSWILDCIRQSEIDAG
LPDSLLPLEPRHVFFATQDKKEEIAASVDRFNDSYARNTTNDELKEILKQMSKDHHFHAS
QNPKIVRKLNERIQEKVNAGWEMPSGWLFKGLTILFPQNDKVDDAEVDETSQTHQQYRLN
LARNTVRFAGANVVDSKSSSVTHIVVAPGSSSSDVSSIRKSHSAKPGKKVPHLVTAEWIE
ECWKQRTLLGEEGFQPSRGT
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atggattctgacgacgattacaatggccctgccgataccaatcctcgcttagaagatgag
gagtctgacctagatgaaaatgagatcaaaaagaagccagctggacctgcgcgcaagaag
gtcggccctcatggactgtctagcgttaatctaactccattggaaaaacggcgagatatt
atcgaccgcttcatctcaagatggaggaaggaggtcggggacgacatataccccgctttt
cgattgattcttcccgacaaagatcgggatagggcaatgtacggaatgaaggagaaggct
atcgggaagcttctaatccgaattatgaaaatcgataagaattcggaggatgctctcaat
ctcttaaactggaaattgcccggacaaacgactacgtctagtatggctggtgatttcgca
ggccgatgcttcggtgtactctcaaagcggccaatgcgcacggaagtgggtgatatgacc
atcgaggaagtgaatgagaaactcgatcatttatccgcggcgtctaaggaaaatcaacag
ttgccgatcttgacggaattctaccgacgaatgaacccagaagagctcatgtggcttatc
cgtatcatcctacgacagatgaaggttggagcgacggagcgcaccttctttgatgtgttc
catccagacgcggagaatctgtacagcatttcgagtagtcttcggcgcgtctgttgggaa
ctgcacgatcctaatatccggcttgaggctgaagatagagggatcacgttgatgcaatgt
ttccaaccgcagctggctcaatttcagatgcactcactggatcggatgattagccggatg
aggctgacggaagatgatccggttttctggattgaggaaaaacttgatggggagcgtatg
cagcttcatatggattcgaacgactcggtaccagggggtagaacgtttcgcttctggtca
agaaaagccaaggactacacatatctctatgggaatggcatccaagatgagaatggtgct
ttgacaagatacctcaacgatgcgtttgcagatggagtggagagcttgattctggatggc
gaaatgattacttgggatactgaacaggatgccattgccccctttggcacgcttaagacg
gccgcactatccgaacagagaaacccgtactcgagcactacccggcccttgttccgtatc
tttgacatactgtatttgaacggacgcgatctgacaaggtacactcttcgtgaccgccga
aacgcattgcagaaaagtatcaaacctgtttatcgcaggtttgaaatccacccttacgaa
gaagctacgggcaaaactgagatcgaggaagccctgcgaagagtcgtggaagaggcttcc
gagggcttggtacttaagaatcccaggtcaccctatcgcctgaatgaaagacacgatgat
tggatgaaggttaagccggaatatatgactgagttcggagagtcgttggatgtcgtcgtg
attggagggtattatggatctggtcatcggggtggtggcctttcaagcttcttatgtggg
ttaagggtcgatgatgctcattcctcacaaggaatggtggcatctaagtgttattcgttc
tgcaaggtaggaggaggctttactgcagctgattatgcaaacatccggcaccacacggac
ggtaaatggcacgagtggaaatccaggaaacctcccacgacatacatagaactggcaggc
ggagatgcgcagtacgagcgcccagacatgtggataaaaccagaagactcggtggttctc
tgcgttaaggcagcttcagtagctgtcagtgatcagtttcgtatcggactgacgctacgc
tttccgcgcttcaaaaagctgcgtatggacaaagattggaaaagcgctctctcagtacaa
gagttcctcgacttaaaagccaatgcggaacgagagcgtaaagagaaagaattcaatgtg
gataattcacgcaagaaacgggcgaagagggataacaagaagcctttagctattgccggg
tacagtgcggaagcagaagctcagtacaccgggccatctggcaatatcttcgaagggcta
aatttctacattacaaccgactcaaacacaccggtcaaaaagtcaaaggcggagttagaa
cagctcgtgaaggctaatgggggcaagttctttcagacgagtaatgctgctccgagcaca
atttgtatcgccgacagaaggactgtgaaagctgcgtcccttcaaaaaagcggcaatgtc
aatattatccggccttcttggatccttgattgtattaggcagagtgaaatagacgcgggt
ttgcctgattctcttcttcctctcgaacccagacatgtcttcttcgcgactcaggacaag
aaggaggagattgcagcgagcgtcgatcggttcaatgatagttatgcccgcaacaccacc
aatgacgaactgaaggagatcttaaagcagatgagcaaggatcatcactttcacgcttcg
cagaatcccaaaatcgtccgaaaactcaacgagcgtatccaggagaaagtcaatgccgga
tgggagatgccttccggctggctgttcaagggtctgaccatcctctttcctcagaatgac
aaagtggatgatgcagaagtagacgagacgtcacaaacgcatcagcaataccgtcttaat
ctagcacgcaacactgtacggtttgcgggagcgaatgttgtggattcgaaatcttcgtcg
gtaactcacatcgtcgtagctccgggcagctcatcttcagacgtctcttcgatccgcaaa
tcgcactcagcgaaaccgggaaagaaggtgccacacctcgtcactgccgaatggatagag
gagtgctggaaacagcggacgctgttgggcgaagaggggttccagccgtccagaggtacc
taa

DBGET integrated database retrieval system