KEGG   Aspergillus flavus: AFLA_099990Help
Entry
AFLA_099990       CDS       T01090                                 

Definition
(RefSeq) succinate dehydrogenase subunit Sdh1, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
afv  Aspergillus flavus
Pathway
afv00020  Citrate cycle (TCA cycle)
afv00190  Oxidative phosphorylation
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
afv01200  Carbon metabolism
Module
afv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
afv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
afv_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFLA_099990
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AFLA_099990
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AFLA_099990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO PAPS_reduct HI0933_like
Motif
Other DBs
NCBI-GeneID: 7919909
NCBI-ProteinID: XP_002383871
UniProt: B8NTR8
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MSSLSLRSLAPASKISRALRDQRRLFSSTRPAARIFGSNPLRAREATGAIAEKYPIIDHE
YDAVVVGAGGAGLRAAFGLAEAGFNTACVSKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPASVRELEGYGCPFSRTEDGRIYQRAFGGQSKEFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLLMEDGECRGIIAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPAELLHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
LTQDENGADKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHRVRDIATPGKP
HRELSSDAGAQSIKDLDFARTADGPKSTFEIRNAMQKAMQTDVSVFRTQESLDEGVAKVT
EIDQLYDQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVAAANRKESRGAHAREDYPDR
DDENWMKHTLTWQKKPHGKIDLGYRAVEHNTLDEKECKPVPPFKRVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagctccctgagcttgcggagcctagctcccgcatccaagatttcccgtgccttgagg
gatcagagacgtcttttttcctcaacccggcccgcagcccggatttttggcagcaaccca
ttgcgcgctagggaagccactggcgctatcgccgagaagtacccgatcattgaccacgag
tacgatgctgtcgtcgtcggtgctggaggtgctggtcttcgtgccgccttcggtctggcg
gaagccggttttaacactgcctgtgtctcgaagctcttccctacaagaagtcacactgtt
gctgcccagggtggtatcaacgctgctcttggaaacatgcacgaggatgactggagatgg
cacatgtacgataccgtgaagggttctgactggctcggagaccaggatgccattcactac
atgaccagagaagcccccgctagtgttcgtgagcttgagggctacggatgccccttctct
cgtaccgaggacggccgtatctaccagcgtgccttcggtggtcagtccaaggaattcgga
aagggcggccaggcctaccgttgctgtgctgccgctgatcgtactggtcacgctcttctt
cacactctctatggacagtccctgcgtcacaacactaactacttcatcgaatacttcgcc
cttgacctgctgatggaggatggtgagtgccgcggtatcattgcctacaaccaggaggat
ggtactctgcaccgtttcaaggcccaccacaccgtcctggccactggtggatacggacgt
gcctacttcagctgcacttctgcccacacttgcactggtgatggtatggccatggttgcc
cgtgctggtcttcccaaccaggatctcgaattcgttcagttccaccccacaggtatctac
ggtgctggatgtctgatcaccgagggttctcgtggtgagggtggttacctgctcaactcc
gagggtgagcgtttcatggagcgttacgctcctaccgccaaggatttggcttctcgtgat
gtcgtttctcgctctatgaccctggaaatccgcgagggccgtggtgttggtcctgagaag
gatcacatctaccttcagctgagccacttgcccgctgagctcttgcacgagcgtctgccc
ggtatctcggaaaccgcttccatcttcgctggtgtcgacgtgaccaagcaacccatcccc
gtcttgcccaccgtccactacaacatgggtggtatccctaccaagtacactggtgaagtc
ctgactcaggatgagaacggtgccgacaaggttgttcctggtctgtacgcttgcggtgaa
gccgcctgcgtgtccgtccacggtgccaaccgtcttggtgccaactctcttctggatttg
gtcgttttcggtcgcgctgtttctcaccgtgtccgtgacattgccacccctggcaagcct
caccgtgagctgagctccgacgctggtgctcagtccatcaaggatctcgacttcgctcgt
actgcggacggccccaagtccactttcgaaatccgtaacgctatgcagaaggccatgcag
actgacgtcagcgtcttccgtactcaggagagtttggatgagggtgtcgccaaggtcact
gagattgaccagttgtacgaccaggtcggtaccaaggaccgcagcatgatctggaactct
gacctcgtggaaactcttgaactccgcaatcttttgacctgcgccacccaaaccgctgtt
gccgccgctaaccgtaaggagtctcgtggtgctcacgcccgtgaggactaccccgaccgt
gatgacgagaactggatgaagcacactctcacgtggcagaagaagccccacggcaagatc
gacctgggctaccgtgccgtcgagcacaacaccctggatgagaaggagtgcaagccggtg
ccacccttcaagcgtgtctactaa

DBGET integrated database retrieval system