KEGG   Aspergillus flavus: AFLA_108830Help
Entry
AFLA_108830       CDS       T01090                                 

Definition
(RefSeq) meiotic recombination protein Mre11
  KO
K10865  double-strand break repair protein MRE11
Organism
afv  Aspergillus flavus
Pathway
afv03440  Homologous recombination
afv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:afv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AFLA_108830
   03450 Non-homologous end-joining
    AFLA_108830
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:afv03032]
    AFLA_108830
   03400 DNA repair and recombination proteins [BR:afv03400]
    AFLA_108830
DNA replication proteins [BR:afv03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     AFLA_108830
DNA repair and recombination proteins [BR:afv03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     AFLA_108830
    BRCA1-C complex
     AFLA_108830
   NHEJ (non-homologous end-joining)
    MRX complex
     AFLA_108830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2 DUF4848 FmdE
Motif
Other DBs
NCBI-GeneID: 7914574
NCBI-ProteinID: XP_002376753
UniProt: B8N8T8
LinkDB All DBs
Position
Unknown
AA seq 785 aa AA seqDB search
MPDLGDAETIRILVATDNHVGYNERDPIRGDDSWKSFHEVMCLARERDVDMVLLAGDLFH
ENKPSRKSMYQVMRSIRMNCLGDKPCELELLSDASENFQGAFNHVNYEDLDINVAIPIFS
IHGNHDDPSGEGHLAALDILQVSGLLNYYGRTPESDNIQVKPVLLQKGRTKLALYGMSNV
RDERLFRTFRDGKVKFYQPSVQKEDWFNLICVHQNHHAYTETGYLPENFLPEFLDLVIWG
HEHECLINPKLNPETKFHVMQPGSSVATSLVPGEAVTKQVSIVSITGRDFKCEPIPLKTV
RPFVMKEIVLSEEKGAQKLARKENNRTEVTRFLMTIVEELIEQAKAEWLAMQEDVEEEEE
LEVPLPLVRLRVEISTPEGGSYDCENPQRFSNRFVGKVANVNDVVQFYRKKKNAANRKKD
DDVDATAVSQLSTLDTVKVEQLVREFLSAQSLSILPQNSFGDAVAQFIDKDDKHAMEMFV
NESLESQIKHLMALDRDNDVMDDEEEAQSSLQQAMNKYRDQMEDMFSRGIKKRSRGKKRF
KPKPDGWDSEFDGVWEDQPGALIHSDNEGDPNEEDAAEDGTGPATTKATSTRGRGRGRGG
RAVATTTTRKAAATAKTTSTAPKKTAPAKTTRGRKKAISDDEDEEDDVIMLDDDDEDEAP
PAAQALSDVDEDDDSQSLFVKQPSTRSRKAAPSTASTQRRGRTAPSPAPSSNTIGGTATR
RSATTRGKQTQMTLDFTGSQISARGSQTTSRSTRLGRKTRATSVLSEEIDDDSDAFESAP
ASRRR
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatcttggtgatgcggaaacaatccgcattctcgttgcaaccgacaaccatgtc
gggtacaacgaacgagaccccatccggggtgatgacagttggaagagtttccatgaggtg
atgtgcctagcccgagagcgtgatgtcgacatggtgctcctcgcaggcgatctctttcac
gagaacaagccttctcgaaaatcaatgtaccaagtaatgcgctcgatcaggatgaactgt
ctgggcgataagccctgtgagctggaattgctcagtgacgccagcgaaaacttccaaggg
gcgttcaaccatgtgaattacgaagatcttgacatcaatgtggctattcctatcttctct
atccatggcaaccatgatgatccctccggagagggccatttggcggcgttggacatactc
caggtttccggactactcaactattatggacggacgcctgagtccgataacattcaggtg
aaaccggtcctacttcagaagggccggaccaaattagcattgtacggtatgagtaacgtc
cgagatgaacgattattccgtacattccgcgacggaaaggtcaagttctaccagccttcg
gttcagaaagaggactggttcaacttgatatgtgtccaccagaatcaccacgcttataca
gagactggatacctccctgaaaactttctcccggagtttcttgatctcgtaatctggggc
cacgaacacgagtgcttgatcaatcctaaattgaatcctgaaaccaaatttcacgtcatg
caaccggggtcttctgtggcgacatcactcgttcccggagaggcagtaacaaaacaagtg
tctatcgtcagtatcaccgggcgcgatttcaaatgcgagcctatcccactgaagaccgtg
cgaccctttgtcatgaaagaaattgtcctctcagaagagaagggggctcagaagttggct
cggaaagaaaacaaccgcactgaagtcacccgttttctaatgacgatcgttgaggagctc
atagaacaagcgaaggctgaatggctggcaatgcaggaagatgtggaagaagaagaggag
ttagaggtgcccttgccactagtgagactgcgtgtggagatctccacaccagagggaggt
agctatgattgcgagaatcctcagcggttttccaatcgttttgtaggcaaggtcgcaaat
gtgaacgatgttgtacaattctaccggaagaaaaagaacgcagcaaaccgcaagaaagat
gatgacgtcgatgcaaccgcagtctcccaactctcgacgctggacacggtgaaggttgaa
caattggtgcgcgaattcctctccgcccaatcgttgagcattcttccacagaattcattc
ggggacgctgtggcccaattcatcgacaaagacgacaagcacgccatggagatgttcgtg
aatgaatctttagaaagtcaaattaaacaccttatggcccttgatcgtgacaatgatgtc
atggacgacgaagaagaggcgcagagctcgctgcaacaggccatgaataagtatcgagat
cagatggaagacatgttctctcgaggcatcaagaagaggtcacgagggaagaagcgattc
aagcctaaaccagatggctgggacagtgaattcgacggcgtctgggaagaccaacccgga
gcgctgatacattcagataacgagggtgatcccaatgaagaagatgctgcagaggatggc
acaggacctgccactacgaaagcaacgtctactcgtggtcggggccgaggtcgtggagga
agagcagtcgctactacaactactcgcaaagcagccgccaccgcgaagaccacatcaacg
gcacccaaaaaaacggcgcccgctaaaacgactagaggacggaaaaaagccatatcggac
gatgaagatgaggaagatgatgtcatcatgctggacgatgacgacgaagatgaagcccct
cccgcagctcaagcgctctctgatgttgatgaggacgatgattctcaatctctatttgtt
aagcaaccatcgacccgaagccgcaaagcagcgccctcgacggccagcacccagcgtcgt
ggacggaccgcgccatccccggcgccatcgtcgaatactataggaggaaccgctacgcgt
aggtctgcaacgacacgaggcaaacaaacccagatgacgttggattttaccggttcccag
attagtgctcgcgggagccagaccacttcgaggtcgacgaggctgggtcggaagactcga
gctacgagtgtgctgagcgaggaaattgatgatgacagcgatgccttcgagtctgcgcca
gcctccagaaggaggtag

DBGET integrated database retrieval system