KEGG   Aspergillus flavus: AFLA_130070Help
Entry
AFLA_130070       CDS       T01090                                 

Definition
(RefSeq) hexokinase Kxk, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
afv  Aspergillus flavus
Pathway
afv00010  Glycolysis / Gluconeogenesis
afv00051  Fructose and mannose metabolism
afv00052  Galactose metabolism
afv00500  Starch and sucrose metabolism
afv00520  Amino sugar and nucleotide sugar metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
afv01200  Carbon metabolism
Module
afv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
afv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_130070
   00051 Fructose and mannose metabolism
    AFLA_130070
   00052 Galactose metabolism
    AFLA_130070
   00500 Starch and sucrose metabolism
    AFLA_130070
   00520 Amino sugar and nucleotide sugar metabolism
    AFLA_130070
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AFLA_130070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:afv04131]
    AFLA_130070
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AFLA_130070
Membrane trafficking [BR:afv04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    AFLA_130070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 7913704
NCBI-ProteinID: XP_002382200
UniProt: B8NPD5
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MVGIGPKRPPSRKGSMHELPQNLLEQIKQFEDIFTVDGAKLKQIADHFVKELEKGLSVEG
GNIPMNVTWVMGFPDGDEQGTFLALDMGGTNLRVCEITLTEEKGAFDITQSKYRMPEELK
TGTAEELWEYIADCLQQFIESHHENEKLSKLPLGFTFSYPATQEYIDHGVLQRWTKGFDI
DGVEGQDVVPPLEAILKKRGLPIKVAALINDTTGTLIASSYTDSDMKIGCIFGTGVNAAY
MEHCGSVPKLAHKNLPPDMPVAINCEYGAFDNEHVVLPLTKYDIIIDRDSPRPGQQAFEK
MTAGLYLGEIFRLALLDLLETRPGLIFQGQDTSQLRKPYLLDASFLAAIEDDPYENLQET
QELMERKLNIKATQQELEMIRRLAELIGTRAARLSACGVAAICKKKNIESCHVGADGSVF
TKYPHFKARGAQALREILDWAPNEKDKVVIMAAEDGSGVGAALIAALTLKRVKAGISCGI
RDMADMQSLI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggttggaattggccccaaacgtcccccatcccgcaagggatcgatgcatgagctgccc
cagaacctgttggagcagatcaagcaattcgaggacatctttaccgtggacggcgccaaa
ctcaagcagattgcggaccatttcgtgaaggagctcgaaaagggtctaagcgtcgagggg
ggtaacattcccatgaatgtgacctgggtcatgggattccccgatggcgacgagcaggga
accttcctcgctttggacatgggcggtactaatctgcgtgtctgtgagatcactttgacg
gaagagaagggcgctttcgacatcacccagtccaagtatcgtatgccggaggagttgaag
acgggtacagcggaggagctttgggaatacatcgccgactgtttgcagcagtttattgaa
tcccaccacgagaatgagaaactgtctaaactgccattgggctttaccttctcctatcct
gctacacaggaatacattgatcatggtgttctccagcgttggacaaagggtttcgacatt
gacggagtagagggccaggatgttgtgcccccattggaggcaatcctcaagaaaagaggc
cttcctatcaaagttgctgcgttgatcaacgacactacgggcaccctgatcgcctcttct
tacaccgactcagatatgaaaattggctgcattttcggcactggtgtcaacgccgcctac
atggaacattgtggctcggttcccaagcttgcacacaagaatctacccccagacatgccc
gtggccatcaactgcgagtacggtgcctttgacaatgagcacgttgttctgcccctcacg
aagtatgatatcatcatcgaccgcgactcccctcgcccaggacaacaagctttcgagaag
atgactgcaggtctttacttgggagaaatattccgtctagccctcttggatctgttggag
acgaggcctggtctgattttccagggccaagacacatcccagctccggaaaccttacttg
ctggacgcgtccttcctcgcagctattgaggatgatccgtacgagaacttgcaggaaact
caggagctcatggagcgcaagctgaacatcaaggccacccagcaggagctggaaatgatc
cgtcgcttggcggagttgatcggcactcgtgcagctcgtctgtcggcgtgtggtgtggct
gccatctgcaagaagaagaacattgagtcttgccatgtgggcgccgacggctctgtcttt
acgaaatatccccacttcaaggcccgtggagcacaggctctgcgcgagatcttggactgg
gcacctaacgagaaggacaaggtggtcatcatggctgctgaagacggttctggtgttgga
gcggctcttattgctgcattgacattgaagcgggtcaaggcaggcatcagctgcggtatc
cgagatatggccgatatgcagagtctcatttaa

DBGET integrated database retrieval system