KEGG   Aspergillus flavus: AFLA_139190
Entry
AFLA_139190       CDS       T01090                                 

Definition
(RefSeq) aflK/ vbs/ VERB synthase
  KO
K17646  5'-oxoaverantin cyclase / versicolorin B synthase [EC:4.2.1.142 4.2.1.143]
Organism
afv  Aspergillus flavus
Pathway
afv00254  Aflatoxin biosynthesis
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AFLA_139190
Enzymes [BR:afv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.142  5'-oxoaverantin cyclase
     AFLA_139190
    4.2.1.143  versicolorin B synthase
     AFLA_139190
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C Pyr_redox_3 DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 Thi4 Lycopene_cycl NAD_binding_9 Trp_halogenase FAD_binding_3 HI0933_like TrkA_N Nucleoporin_FG2
Other DBs
NCBI-GeneID: 7914310
NCBI-ProteinID: XP_002379930
UniProt: B8NHY3
LinkDB
Position
Unknown
AA seq 643 aa
MGRNWFQVTAMAVVPVVGIMAAVNPTILSSAASSLPSLGAMFTSDDFASQMDGRIQAQGL
LSSHFGMYGWPGQSFDYVIVGGGTAGLAMARRLSQDGTASVAVIEAGGFYETDAGNATEV
PMYLFNYFFDNGKVKNPLFDWYQYTTPQPGLAQREMFYMQGKTLGGSTARGAMLYHRGSK
GAYDMWADHVGDDSYRWDKWLPYFQKSVHFSGPETNPRPANATALNDNTAFTASGGPVHV
GYPFQVNAISSWVDKALAKMGFPEAQGFSNGNLLGRSYITHTINPYTRRRETASSSYLRE
ALMESKNLNIFTRTLVKRVLFDDQNRATGVTVSTDGFEWQIGAKKEVILSAGVMRSPQLL
MVSGIGPKEHLEQLGIPVRSDLSGVGQNMQDTIILGPTVPVKVESHSQLMGNKETLPRAI
REYNEQRKGLLTNPGQDYFAFEKHQPGMLKESTAADIDAAFPDDWPTFSYIALDDTFVPQ
YDGKNYFSMSAALMTPFSRGTVTINSNDTANPPIVDPQWLADPRDQEMAVAAFRRCREIV
ASDVMREVVAGPEILPGPQYQTDEEILNYIAETSDAYYAGVGTCAMGKADDSKAVVDSKA
RVLGVKGLRVVDASIFPFAIDGQPMGTVYALAEKIAAEMMAEQ
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgggacgaaactggttccaggtaacagccatggcggtggtccccgtggtgggcatcatg
gccgctgtcaatccgaccatcttgtcctccgcagcttcctccctcccatcgctaggggca
atgttcacatcggacgattttgctagccaaatggacgggcgcattcaggcacagggattg
ctcagctcgcactttggcatgtacggatggccgggacagtcattcgactacgtgattgtc
ggcggtggaacagcaggcctggctatggcccgtcgcctgtcccaggatggaactgcttca
gttgccgtgattgaggcgggaggattttatgaaaccgatgctggcaatgccaccgaggtt
ccgatgtatctgttcaactacttcttcgacaatggcaaggtcaaaaaccctctatttgac
tggtatcaatacaccacaccgcaacccgggctggcacagcgcgaaatgttttatatgcag
ggaaagaccttgggcggaagcactgcacgaggggccatgttgtaccacagaggctcgaaa
ggcgcatacgatatgtgggcagatcacgttggcgacgatagttacagatgggataaatgg
ctgccctatttccagaagagcgttcatttctctggtccagaaacgaaccctcgtcctgcg
aatgctacggctctcaacgacaacacggccttcacggcttcgggaggccccgtacacgtc
ggctatccgttccaggttaatgccatctcgtcctgggtggacaaggctctggccaaaatg
ggctttcctgaagctcagggcttctccaatggcaacctgttgggccgttcatacataact
cacaccatcaacccctacacccgtcgccgcgagaccgcttcgtcttcctatctccgcgag
gcgctgatggaaagtaagaacctcaacatctttacacgcactctggttaaacgggtcctt
ttcgacgatcagaatcgagcgacaggagtaaccgtaagcaccgacggcttcgagtggcag
atcggagccaagaaggaggtcattctgagcgccggcgtcatgcgttcaccccagctgcta
atggtgtctggaatcgggcccaaagagcatttggagcagctgggcattccagtacgatct
gatctcagcggagtgggccaaaacatgcaggacaccattatcctggggcctacagttcca
gtcaaggtcgagagccacagtcagttgatgggtaacaaagagacactgccccgggctatt
cgcgagtacaacgagcagcgtaagggtctgttgaccaatccaggccaggattattttgcg
tttgagaaacaccagccaggcatgctgaaggagtctaccgccgccgatatcgacgccgca
tttcccgatgactggccgaccttttcatatattgcactggacgacaccttcgttccacaa
tatgacggcaagaattattttagcatgtctgccgctctgatgactcccttcagtcgtggt
acggtcacgatcaacagcaatgatacagccaacccgcccatcgtggacccacaatggttg
gccgatccaagagaccaggagatggcggttgctgctttccgtcgttgtcgcgagattgtt
gcatcggacgtgatgcgagaggtcgttgctggacccgagattttgcccgggccgcagtat
cagacggatgaagaaatactaaactatatcgccgagacatcagatgcttattatgccggg
gtaggcacctgcgctatgggcaaagcagatgattccaaggctgtagtagattccaaggcc
agagtcttgggcgttaagggcctacgcgtggttgatgcttcaatctttccgtttgcgatt
gatggacagcccatgggcactgtgtatgctctggctgaaaagattgcagctgaaatgatg
gctgagcagtag

DBGET integrated database retrieval system