KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_0375Help
Entry
Anae109_0375      CDS       T00559                                 

Definition
(GenBank) glutamine amidotransferase of anthranilate synthase
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Pathway
afw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afw01100  Metabolic pathways
afw01110  Biosynthesis of secondary metabolites
afw01130  Biosynthesis of antibiotics
afw01230  Biosynthesis of amino acids
afw02024  Quorum sensing
Module
afw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Anae109_0375
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Anae109_0375
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Anae109_0375
Enzymes [BR:afw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Anae109_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ABS24590
UniProt: A7H794
LinkDB All DBs
Position
complement(427387..427968)
Genome map
AA seq 193 aa AA seqDB search
MLLLDNYDSFTFNLVQYLGELGADVEVFRNDAIDVAGIQARRPDGLVLSPGPCTPDDAGV
TLEAIAALAGELPILGVCLGHQAIGQAFGGKVIRNARIVHGKASPVLHAGAGVFAGLPSP
FEAGRYHSLVVERETLPAALEITAWTEEEEIMGLRHRALDVEGVQFHPESILTAEGKRLL
GNWLRRLDGGRAR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgctcctgctggacaactacgactcgttcaccttcaacctggtccagtacctcggcgag
ctcggcgccgacgtcgaggtgttccgcaacgacgccatcgacgtcgcggggatccaggcg
cgccgcccggacggcctcgtgctctcccccgggccgtgcacgccggacgacgcgggcgtg
acgctcgaggccatcgccgcgctcgcgggcgagctgcccatcctcggcgtgtgcctgggg
caccaggccatcggccaggccttcgggggcaaggtgatccgcaacgcgcgcatcgtgcac
gggaaggcgagcccggtcctgcacgccggggcgggcgtgttcgcggggctgccgtcgccg
ttcgaggcggggcgctaccactcgctcgtcgtcgagcgggagacgttgcccgcggccctc
gagatcaccgcctggaccgaggaggaagagatcatggggctgcggcaccgggcgctggac
gtggagggcgtccagttccaccccgagtcgatcctgaccgccgagggcaagcggctcctc
ggcaactggctccgccgcctcgacggcgggagggcgcgatga

DBGET integrated database retrieval system