KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_1585Help
Entry
Anae109_1585      CDS       T00559                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
afw  Anaeromyxobacter sp. Fw109-5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABS25789
UniProt: A7HAP3
LinkDB All DBs
Position
complement(1782228..1783280)
Genome map
AA seq 350 aa AA seqDB search
MVPPIPPMLARPVRELPEGDLSYEPKWDGFRCLAFAAPAGEVDLRSRNQRPLARYFPELV
EALRALPRSAVLDGEIVVASARGFDFPALLARLHPSASRVARLSRETPAVYVAFDLLADG
DEDLRPRPFRERRARLEALLAGARSPLRLTPATFDPSVARAWLERLGGAGIDGVVAKPLG
LPYQAGRRSMLKVKRELTADCVVAGLRTFAGEPVVASLLLGLWDHTGALHHVGVVSSFPE
RERRALFASLGPLQAPLAGHPWERGFNLASGPTGRLAGAAGRWDPREMALDWTPLSPERV
AEVAYDRLDALRFRHPARLVRWRPDREARSCTLDQLAGDAPEPPEAFGAR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtggtgccaccgatcccgcccatgctcgcccgcccggtgcgcgagctgccggagggtgac
ctctcgtacgagccgaagtgggacgggttccgctgcctcgccttcgcggcgccggcgggc
gaggtcgacctgcgcagccggaaccagcggccgctcgcgcgctacttcccggagctggtg
gaggcgctccgcgccctgccgcgctcggccgtgctggacggcgagatcgtggtcgcgagc
gcgcgcgggttcgacttccccgcgctcctcgcccgcttgcacccctccgcctcgcgcgtg
gcgcggctcagccgggagaccccggcggtctacgtcgcgttcgacctgctcgccgatggc
gacgaggaccttcggccgcgcccgttccgcgagcggcgggcacggctcgaggccctcctc
gccggggcgcgctctccgctccggctgacgcctgcgacgttcgatccctcggtcgcgcgg
gcgtggctggagcggcttgggggcgccgggatcgacggcgtcgtcgcgaagccactcggg
ctgccctaccaggccgggcggcgctccatgctgaaggtgaagcgggagctcacggccgac
tgcgtggtcgcgggcctgcgcaccttcgcgggggaaccggtcgtcgcctccctcctcctc
ggtctttgggaccacaccggggcgctccaccacgtgggcgtcgtctcgagcttccccgag
cgggagcgccgcgcgctcttcgcgtcgctggggccgctccaggcgccgctcgccggacat
ccctgggagcgcggcttcaacctcgcgagcggcccgacgggccggctcgccggcgccgcc
ggccgctgggatccgcgcgagatggcgctggactggaccccgctctcgcccgagcgcgtg
gcggaggtcgcctacgatcgcctggacgcgctgcgcttccgccaccccgcgcgcctcgtc
cgctggcggccggatcgcgaggcgcgctcgtgcacgctggaccagctcgccggcgacgcg
ccggagccgccggaggcgttcggcgcgcgatga

DBGET integrated database retrieval system