KEGG   Addendum: AAA16128
Entry
AAA16128          CDS       T10000                                 

Gene name
doxE
Definition
(KEGG) dibenzothiophene dihydrodiol dehydrogenase (EC:1.3.1.60)
  KO
K14582  cis-1,2-dihydro-1,2-dihydroxynaphthalene/dibenzothiophene dihydrodiol dehydrogenase [EC:1.3.1.29 1.3.1.60]
Taxonomy
TAX:306
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas sp.)
SSDB
Motif
Pfam: adh_short_C2 adh_short NmrA NAD_binding_10 Epimerase
Other DBs
NCBI-ProteinID: AAA16128
GB: M60405
UniProt: P0A170
LinkDB
AA seq 259 aa
MGNQQVVSITGAGSGIGLELVRSFKSAGYYVSALVRNEEQEALLCKEFKDALEIVVGDVR
DHATNEKLIKQTIDRFGHLDCFIANAGIWDYMLSIEEPWEKISSSFDEIFDINVKSYFSG
ISAALPELKKTNGSVVMTASVSSHAVGGGGSCYIASKHAVLGMVKALAYELAPEVRVNAV
SPGGTVTSLCGPASAGFDKMHMKDMPGIDDMIKGLTPLGFAAKPEDVVAPYLLLASRKQG
KFITGTVISIDGGMALGRK
Comment
The start codon in the ORF is changed from position 2466 to position 2514.
Reference
PMID:8226631
  Authors
Denome SA, Stanley DC, Olson ES, Young KD
  Title
Metabolism of dibenzothiophene and naphthalene in Pseudomonas strains: complete DNA sequence of an upper naphthalene catabolic pathway.
  Journal
J Bacteriol 175:6890-901 (1993)
DOI:10.1128/JB.175.21.6890-6901.1993

DBGET integrated database retrieval system