KEGG   Addendum: AAA65203
Entry
AAA65203          CDS       T10000                                 

Gene name
dpsF
Definition
(KEGG) bifunctional aromatase (cyclase/dehydratase)
  KO
K15884  bifunctional aromatase (cyclase/dehydratase) [EC:4.2.1.-]
Taxonomy
TAX:1950
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces peucetius)
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc AHSA1
Other DBs
NCBI-ProteinID: AAA65203
GB: L35560
UniProt: Q54811
LinkDB
AA seq 315 aa
MSELPLQQTEHEIHTSAAPDAVFAVLADARAWPAVFPPSVHVEQVEHTGSSERIRIWATA
NGSLRTWTSRRELDERARRIRFRQEVSAHPVAAMGGEWIVEEAGDGGTRVRLTHDFRAVD
DDPETIGWIHRAVDRNSEAELASLRTALERPDGTAPTTFEDTVVVRGRAEDVYDFLHRSD
LWKKRLSHVARIAVKEEEPGLQHMEMDTLTADGSVHTTASVRVCFPERRVIVYKQLRTPP
LLALHLGRWSVRPADDGDGIAVTSAHTVSVARSAIPGVLGAGASETDAVDFVRRALGRNS
LLTLEAARQYAESSA
Reference
PMID:7828855
  Authors
Grimm A, Madduri K, Ali A, Hutchinson CR
  Title
Characterization of the Streptomyces peucetius ATCC 29050 genes encoding doxorubicin polyketide synthase.
  Journal
Gene 151:1-10 (1994)
DOI:10.1016/0378-1119(94)90625-4

DBGET integrated database retrieval system