KEGG   Addendum: AAA91577
Entry
AAA91577          CDS       T10000                                 

Gene name
nahC
Definition
(KEGG) 1,2-dihydroxynaphthalene dioxygenase (EC:1.13.11.56)
  KO
K14583  1,2-dihydroxynaphthalene dioxygenase [EC:1.13.11.56]
Taxonomy
TAX:303
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas putida)
SSDB
Motif
Pfam: Glyoxalase YdiH
Other DBs
NCBI-ProteinID: AAA91577
GB: J04994
UniProt: P11861
LinkDB
AA seq 302 aa
MSKQAAVIELGYMGISVKDPDAWKSFAMNMLGLQVLDEGEKDRFYLRMDYWHHRIVVHHS
AEDDLEYLGWRVAGKPEFEALGQKLIDAGYKIRVCDKVEAQERMVLGLMKTEDPGGNPTE
IFWGPRIDMSNPFHPGRPLHGKFVTGDQGLGHCIVRQTDVAAAHKFYSLLGFRGDVEYRI
PLPNGMTAELSFMHCNARDHSIAFGAMPAAKRLNHLMLEYTHMEDLGYTHQQFVKNEIDI
ALQLGIHANDKALTFYGATPSGWLIEPGWRGATAIDEAEYYVGDIFGHGVEAPGYGLDVK
LS
Reference
PMID:2670937
  Authors
Harayama S, Rekik M
  Title
Bacterial aromatic ring-cleavage enzymes are classified into two different gene families.
  Journal
J Biol Chem 264:15328-33 (1989)
Reference
PMID:7204331
  Authors
Patel TR, Barnsley EA
  Title
Naphthalene metabolism by pseudomonads: purification and properties of 1,2-dihydroxynaphthalene oxygenase.
  Journal
J Bacteriol 143:668-73 (1980)
DOI:10.1128/JB.143.2.668-673.1980

DBGET integrated database retrieval system