KEGG   Addendum: AAA99002Help
Entry
AAA99002          CDS       T10000                                 

Gene name
dnrP
Definition
(KEGG) 10-carbomethoxy-13-deoxycarminomycin esterase
  KO
K15953  10-carbomethoxy-13-deoxycarminomycin esterase
Taxonomy
TAX:1950
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces peucetius)
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_4 DUF5437
Motif
Other DBs
NCBI-ProteinID: AAA99002
GB: L40425
UniProt: Q54809
LinkDB All DBs
AA seq 298 aa AA seqDB search
MPTRMITNDEVTLWSEGLGDPADAPLLLIAGGNLSAKSWPDEFVERLVAAGHFVIRYDHR
DTGRSSRCDFALHPYGFDELAADALAVLDGWQVRAAHVVGMSLGNTIGQLLALDAPERLL
TLTVMLGGALDVDFDADLEAALKGEPSVSGLPVPSQRFLDMMTMLQQPAETDEELLERRV
EKWRLLNGEGVPFDADEFRRRELLAAGHAGTFDEPIVHHMIPLPPVSRGAELSRVTTPVL
AIQAMCDPAAPPPHARHLANRIPGARVVEIENMGHALPLAVHEPLAAAICAHTRAATV
Reference
PMID:7601857
  Authors
Madduri K, Hutchinson CR
  Title
Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius.
  Journal
J Bacteriol 177:3879-84 (1995)
DOI:10.1128/JB.177.13.3879-3884.1995

DBGET integrated database retrieval system