KEGG   Addendum: AAB06725
Entry
AAB06725          CDS       T10000                                 

Gene name
nsaC
Definition
(KEGG) 1,2-dihydroxynaphthalene dioxygenase (EC:1.13.11.56)
  KO
K14583  1,2-dihydroxynaphthalene dioxygenase [EC:1.13.11.56]
Taxonomy
TAX:121428
  Lineage
Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingobium
Organism
ag  Addendum (Sphingobium xenophagum)
SSDB
Motif
Pfam: Glyoxalase
Other DBs
NCBI-ProteinID: AAB06725
GB: U65001
UniProt: P74836
LinkDB
AA seq 298 aa
MSSVSELGYLGMSVTDLDAWRAYAAEVAGMEVVDEGESDRIYLRMDLWHHRIALIKGDTD
DLAYMGWRLGDPTEFESMVEKLTNAGIAVTVASDAEARERRVLGLAKLTDPGGNPTEIFY
GPQVDAHKPFHPGRPMFGKFVTGSEGIGHCILRQDDVEAAAAFYRLLGLRGSVEYQLHLP
NGMVAMPYFMHCNERQHSVAFGLGPMEKRINHLMFEYTELDDLGLAHDIVRERQIDVALQ
LGKHANDLALTFYCANPSGWLWEFGWGARKAPAQQEFYTRDIFGHGNEAQGYGMDVPL
Reference
  Authors
Keck A, Conradt D, Mahler A, Stolz A, Mattes R, Klein J
  Title
Identification and functional analysis of the genes for naphthalenesulfonate catabolism by Sphingomonas xenophaga BN6.
  Journal
Microbiology 152:1929-40 (2006)
DOI:10.1099/mic.0.28783-0
Reference
PMID:2050635
  Authors
Kuhm AE, Stolz A, Ngai KL, Knackmuss HJ
  Title
Purification and characterization of a 1,2-dihydroxynaphthalene dioxygenase from a bacterium that degrades naphthalenesulfonic acids.
  Journal
J Bacteriol 173:3795-802 (1991)
DOI:10.1128/JB.173.12.3795-3802.1991

DBGET integrated database retrieval system