KEGG   Addendum: AAB16939Help
Entry
AAB16939          CDS       T10000                                 

Gene name
dauP
Definition
(KEGG) 10-carbomethoxy-13-deoxycarminomycin esterase
  KO
K15953  10-carbomethoxy-13-deoxycarminomycin esterase
Taxonomy
TAX:1931
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces sp.)
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_4 DUF5437
Motif
Other DBs
NCBI-ProteinID: AAB16939
GB: L35154
UniProt: Q55217
LinkDB All DBs
AA seq 298 aa AA seqDB search
MPTRMITKDEVTLWSEGIGDPADAPLLLIAGGNLSARSWPDEFVERLAAAGHFVIRYDHR
DTGRSSRYDFALHPYGFDELATDALAVLDAWQVRAAHVVGMSLGNTIGQLLALDAPERLL
TLTVMLGGALDVDFDADLEAALKGEPSVSGLPVPSRRFLDMMMLLQQPAGTDEELLERRV
EKWRLLNGEGVPFDSDEFRRRELLAAGHAGTFDEPIVHHMIPQPPVSRGAELARITTPVL
AIQAMCDPAAPPPHARHLADRIPGARVVEIENMGHALPLAVHEPLAAAICAHTRAATV
Reference
PMID:7836284
  Authors
Dickens ML, Ye J, Strohl WR
  Title
Analysis of clustered genes encoding both early and late steps in daunomycin biosynthesis by Streptomyces sp. strain C5.
  Journal
J Bacteriol 177:536-43 (1995)
DOI:10.1128/JB.177.3.536-543.1995

DBGET integrated database retrieval system