KEGG   Addendum: AAC31901
Entry
AAC31901          CDS       T10000                                 

Gene name
bls
Definition
(KEGG) (carboxyethyl)arginine beta-lactam-synthase (EC:6.3.3.4)
  KO
K12674  (carboxyethyl)arginine beta-lactam-synthase [EC:6.3.3.4]
Taxonomy
TAX:1901
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces clavuligerus)
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase QueC
Other DBs
NCBI-ProteinID: AAC31901
GB: AF071051
UniProt: P0DJQ7
LinkDB
Structure
PDB: 
1M1Z 1JGT 1MB9 1MC1 1MBZ

AA seq 513 aa
MGAPVLPAAFGFLASARTGGGRAPGPVFATRGSHTDIDTPQGERSLAATLVHAPSVAPDR
AVARSLTGAPTTAVLAGEIYNRDELLSVLPAGPAPEGDAELVLRLLERYDLHAFRLVNGR
FATVVRTGDRVLLATDHAGSVPLYTCVAPGEVRASTEAKALAAHRDPKGFPLADARRVAG
LTGVYQVPAGAVMDIDLGSGTAVTHRTWTPGLSRRILPEGEAVAAVRAALEKAVAQRVTP
GDTPLVVLSGGIDSSGVAACAHRAAGELDTVSMGTDTSNEFREARAVVDHLRTRHREITI
PTTELLAQLPYAVWASESVDPDIIEYLLPLTALYRALDGPERRILTGYGADIPLGGMHRE
DRLPALDTVLAHDMATFDGLNEMSPVLSTLAGHWTTHPYWDREVLDLLVSLEAGLKRRHG
RDKWVLRAAMADALPAETVNRPKLGVHEGSGTTSSFSRLLLDHGVAEDRVHEAKRQVVRE
LFDLTVGGGRHPSEVDTDDVVRSVADRTARGAA
Reference
PMID:9689037
  Authors
Bachmann BO, Li R, Townsend CA
  Title
beta-Lactam synthetase: a new biosynthetic enzyme.
  Journal
Proc Natl Acad Sci U S A 95:9082-6 (1998)
DOI:10.1073/pnas.95.16.9082

DBGET integrated database retrieval system