KEGG   Addendum: AAC49318
Entry
AAC49318          CDS       T10000                                 

Gene name
vbs
Definition
(KEGG) versicolorin B synthase (EC:4.2.1.142 4.2.1.143)
  KO
K17646  5'-oxoaverantin cyclase / versicolorin B synthase [EC:4.2.1.142 4.2.1.143]
Taxonomy
TAX:5067
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus
Organism
ag  Addendum (Aspergillus parasiticus)
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO Pyr_redox_3 FAD_binding_2 Pyr_redox_2 NAD_binding_8 Thi4 Lycopene_cycl NAD_binding_9 Trp_halogenase FAD_binding_3 HI0933_like TrkA_N Nucleoporin_FG2
Other DBs
NCBI-ProteinID: AAC49318
GB: U51327
UniProt: Q12062
LinkDB
AA seq 643 aa
MGRNWFQVTAMAVVPVVGIMAAVNPTILSSAASSLPSLGAMFTSDDFASQMDGRIQAQGL
LSSHFGMYGWPGQSFDYVIVGGGTAGLAMARRLSQDGTASVAVIEAGGFYETDAGNATEV
PMYLFNYFFDNGKVKNPLFDWYQYTTPQPGLAQREMFYMQGKTLGGSTARGAMLYHRGSK
GAYDMWADHVGDDSYRWDKWLPYFQKSVHFSGPETNPRPANATALNDNTAFTASGGPVHV
GYPFQVNAISSWVDRALAKMGFPEAQGFSNGNLLGRSYITHTINPYTRRRETASSSYLRE
ALMESNNLNIFTRTLVKRVLFDDQNRATGVTVNTDGFEWQIGARKEVILSAGVMRSPQLL
MVSGIGPKDHLEQLGIPVRSDLSGVGQNMQDTIILGPTVPVKVESHSQLMGNKETLPRAI
REYNEQRKGLLTNPGQDYFAFEKHQPGMLKESTAADIDAAFPDDWPTFSYIALDDTFVPQ
YDGKNYFSMSAALMTPFSRGTVTINSNDTANPPIVDPQWLADPRDQEMAVAAFRRCREIV
ASDVMREVVAGPEILPGPQYQTDEEILNYIAETSDAYYAGVGTCAMGKADDPKAVVDSKA
RVLGVKGLRIVDASIFPFAIDGQPMGTVYALAEKIAAEMMAGQ
Reference
PMID:8662689
  Authors
Silva JC, Minto RE, Barry CE 3rd, Holland KA, Townsend CA
  Title
Isolation and characterization of the versicolorin B synthase gene from Aspergillus parasiticus. Expansion of the aflatoxin b1 biosynthetic gene cluster.
  Journal
J Biol Chem 271:13600-8 (1996)
DOI:10.1074/jbc.271.23.13600
Reference
  Authors
Sakuno E, Wen Y, Hatabayashi H, Arai H, Aoki C, Yabe K, Nakajima H
  Title
Aspergillus parasiticus cyclase catalyzes two dehydration steps in aflatoxin biosynthesis.
  Journal
Appl Environ Microbiol 71:2999-3006 (2005)
DOI:10.1128/AEM.71.6.2999-3006.2005

DBGET integrated database retrieval system