KEGG   Addendum: AAC68680
Entry
AAC68680          CDS       T10000                                 

Gene name
desV
Definition
(KEGG) dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase (EC:2.6.1.106)
  KO
K13310  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase [EC:2.6.1.106]
Taxonomy
TAX:54571
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces venezuelae)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase AMP-binding
Other DBs
NCBI-ProteinID: AAC68680
GB: AF079762
UniProt: Q9ZGH4
LinkDB
Structure
PDB: 
2OGA 2OGE

AA seq 379 aa
MSSRAETPRVPFLDLKAAYEELRAETDAAIARVLDSGRYLLGPELEGFEAEFAAYCETDH
AVGVNSGMDALQLALRGLGIGPGDEVIVPSHTYIASWLAVSATGATPVPVEPHEDHPTLD
PLLVEKAITPRTRALLPVHLYGHPADMDALRELADRHGLHIVEDAAQAHGARYRGRRIGA
GSSVAAFSFYPGKNLGCFGDGGAVVTGDPELAERLRMLRNYGSRQKYSHETKGTNSRLDE
MQAAVLRIRLAHLDSWNGRRSALAAEYLSGLAGLPGIGLPVTAPDTDPVWHLFTVRTERR
DELRSHLDARGIDTLTHYPVPVHLSPAYAGEAPPEGSLPRAESFARQVLSLPIGPHLERP
QALRVIDAVREWAERVDQA
Reference
PMID:9770448
  Authors
Xue Y, Zhao L, Liu HW, Sherman DH
  Title
A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity.
  Journal
Proc Natl Acad Sci U S A 95:12111-6 (1998)
DOI:10.1073/pnas.95.21.12111
Reference
  Authors
Burgie ES, Thoden JB, Holden HM
  Title
Molecular architecture of DesV from Streptomyces venezuelae: a PLP-dependent transaminase involved in the biosynthesis of the unusual sugar desosamine.
  Journal
Protein Sci 16:887-96 (2007)
DOI:10.1110/ps.062711007

DBGET integrated database retrieval system