KEGG   Addendum: AAC68684
Entry
AAC68684          CDS       T10000                                 

Gene name
desI
Definition
(KEGG) dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Taxonomy
TAX:54571
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces venezuelae)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase SHMT
Other DBs
NCBI-ProteinID: AAC68684
GB: AF079762
UniProt: Q9ZGH0
LinkDB
Structure
PDB: 
2PO3

AA seq 415 aa
MKSALSDLAFFGGPAAFDQPLLVGRPNRIDRARLYERLDRALDSQWLSNGGPLVREFEER
VAGLAGVRHAVATCNATAGLQLLAHAAGLTGEVIMPSMTFAATPHALRWIGLTPVFADID
PDTGNLDPDQVAAAVTPRTSAVVGVHLWGRPCAADQLRKVADEHGLRLYFDAAHALGCAV
DGRPAGSLGDAEVFSFHATKAVNAFEGGAVVTDDADLAARIRALHNFGFDLPGGSPAGGT
NAKMSEAAAAMGLTSLDAFPEVIDRNRRNHAAYREHLADLPGVLVADHDRHGLNNHQYVI
VEIDEATTGIHRDLVMEVLKAEGVHTRAYFSPGCHELEPYRGQPHAPLPHTERLAARVLS
LPTGTAIGDDDIRRVADLLRLCATRGRELTARHRDTAPAPLAAPQTSTPTIGRSR
Reference
PMID:9770448
  Authors
Xue Y, Zhao L, Liu HW, Sherman DH
  Title
A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity.
  Journal
Proc Natl Acad Sci U S A 95:12111-6 (1998)
DOI:10.1073/pnas.95.21.12111

DBGET integrated database retrieval system