KEGG   Addendum: AAD44154
Entry
AAD44154          CDS       T10000                                 

Gene name
vioA
Definition
(KEGG) dTDP-4-amino-4,6-dideoxy-D-glucose transaminase (EC:2.6.1.33)
  KO
K20429  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Taxonomy
TAX:562
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia
Organism
ag  Addendum (Escherichia coli)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase SelA Cys_Met_Meta_PP SHMT
Other DBs
NCBI-ProteinID: AAD44154
GB: AF125322
UniProt: Q9XCW4
LinkDB
AA seq 371 aa
MNDKTIPVTQPSLPELAEFMPYLEKIWKNKWLTNNGPFHQELEEKLCEFLGVQHISLFNN
ATIALITALQALRITGEVITTPYSFVATSHAILWNGLTPVFVDIENDGYNIDYRKIEQAI
TPKTSAILPVHCYSTPCEVEEIQKIADNYGLKVIYDAAHAFGVNFKGGKVYLTMVIYQFL
VSMRRKSSINFEGGAIISPDAKTKLRIDRLKNFGIADELTVTAPGINGKMSEINAAFGLV
QLKHIEGSISKRKIIDSLYRNLLKGTPGITIFPGNINTNSNYSYFPILIDDGFHMSRDQA
YELLKKNNILSRKYFYPLISNMPMYRGLISASVDNLPIANSVADKVLCLPIYTDLNEEIV
VKITKLLLGKM
Reference
  Authors
Marolda CL, Feldman MF, Valvano MA
  Title
Genetic organization of the O7-specific lipopolysaccharide biosynthesis cluster of Escherichia coli VW187 (O7:K1).
  Journal
Microbiology 145 ( Pt 9):2485-95 (1999)
DOI:10.1099/00221287-145-9-2485
Reference
  Authors
Wang Y, Xu Y, Perepelov AV, Qi Y, Knirel YA, Wang L, Feng L
  Title
Biochemical characterization of dTDP-D-Qui4N and dTDP-D-Qui4NAc biosynthetic pathways in Shigella dysenteriae type 7 and Escherichia coli O7.
  Journal
J Bacteriol 189:8626-35 (2007)
DOI:10.1128/JB.00777-07

DBGET integrated database retrieval system