KEGG   Addendum: AAD49559Help
Entry
AAD49559          CDS       T10000                                 

Definition
(KEGG) linoleate 8R-lipoxygenase / 9,12-octadecadienoate 8-hydroperoxide 8S-isomerase (EC:1.13.11.60 5.4.4.6)
  KO
K17864  linoleate 8R-lipoxygenase / 9,12-octadecadienoate 8-hydroperoxide 8S-isomerase [EC:1.13.11.60 5.4.4.6]
Taxonomy
TAX:29850
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Sordariomycetidae; Magnaporthales; Magnaporthaceae; Gaeumannomyces
Organism
ag  Addendum (Gaeumannomyces graminis)
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-ProteinID: AAD49559
GB: AF124979
UniProt: Q9UUS2
LinkDB All DBs
AA seq 1165 aa AA seqDB search
MTVSTHHDDSPGLSGRLRDLLHHVFGNQKSPTVYPNAPGNSAKPVPTGLADDIDKLGFKD
IDTLLIFLNSAVKGVNDDQQFLLEKMIQLLAKLPPASREGKKLTDGLINDLWDSLDHPPV
ASLGKGFSFREPDGSNNNIHLPSLGAANTPYARSTKPLVFQNPNPPDPATIFDTLMVRDP
AKFRPHPNKISSMLFYLATIITHDIFQTSPRDFNINLTSSYLDLSPLYGRNHDEQMAVRT
GKDGLLKPDTFSSKRVIGFPPGVGAFLIMFNRFHNYVVTQLAKINEGGRFKRPTTPDDTA
GWETYDNSLFQTGRLITCGLYINIVLGDYVRTILNLNRANTTWNLDPRTKEGKSLLSKPT
PEAVGNQVSVEFNLIYRWHCTISERDDKWTTNAMREALGGQDPATAKMEDVMRALGMFEK
NIPDEPEKRTLAGLTRQSDGAFDDTELVKILQESIEDVAGAFGPNHVPACMRAIEILGIK
QSRTWNVATLNEFRQFIGLTPHDSFYHMNPDPKICKILAQMYDSPDAVELYPGIMAEAAK
PPFSPGSGLCPPYTTSRAILSDAVSLVRGDRFYTVDYTPRNITNWGFNEASTDKAVDWGH
VIYKLFFRAFPNHFLPNSVYAHFPFVVPSENKLIFEGLGAANKYSWDPPKARAPIQFIRS
HKAVLEVLSNQKDYKVTWGPAIKMLSGDPATSFALAGDEPANAASRHHVIAALTAPKQWR
DEVRRFYEVTTRDLLRRHGAPVHGVGAGPRTHEVDVIRDVIGLAHARFMASLFSLPLKEE
GKEEGAYGEHELYRSLVTIFAAIFWDSDVCNSLKLHQASKAAADKMSALIAEHVREMEAG
TGFLGALGKLKDLITGNDVHANGNGVYTNGNGVYTNGNGVHTNGNGVHTNGNGVPHAAPS
LRSFGDQLLQRMLSQDGRSIEETVSGTILPVVMAGTANQTQLLAQCLDYYLGVGEKHLPE
MKRLAMLNTSEADEKLLKYTMEGCRIRGCVALYRAVVTDQAVDDTIPCIPNKDDPTFARP
LSNPQVAESARTLKLSTGTRMLVDLTTASHDPAAFPDPDEVRLDRPLESYVHFGLGPHRC
AGEPISQIALSSVMKVLLQLDGLRRAAGPRGEIRSYPASQWPGQAGRPPRDPAWSGLRTF
TSADQSAFSPLATTMKINWEGRGDL
Reference
  Authors
Hornsten L, Su C, Osbourn AE, Garosi P, Hellman U, Wernstedt C, Oliw EH
  Title
Cloning of linoleate diol synthase reveals homology with prostaglandin H synthases.
  Journal
J Biol Chem 274:28219-24 (1999)
DOI:10.1074/jbc.274.40.28219
Reference
PMID:8662736
  Authors
Su C, Oliw EH
  Title
Purification and characterization of linoleate 8-dioxygenase from the fungus Gaeumannomyces graminis as a novel hemoprotein.
  Journal
J Biol Chem 271:14112-8 (1996)
DOI:10.1074/jbc.271.24.14112

DBGET integrated database retrieval system