KEGG   Addendum: AAF67510
Entry
AAF67510          CDS       T10000                                 

Gene name
novQ
Definition
(KEGG) 4-hydroxyphenylpyruvate 3-dimethylallyltransferase (EC:2.5.1.111)
  KO
K12707  4-hydroxyphenylpyruvate 3-dimethylallyltransferase [EC:2.5.1.111]
Taxonomy
TAX:193462
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces niveus)
SSDB
Motif
Pfam: PTase_Orf2
Other DBs
NCBI-ProteinID: AAF67510
GB: AF170880
UniProt: Q9L9F1
LinkDB
AA seq 323 aa
MPALPMNQEFDRERFRVDLRATAAAIGAPVTPRVTDTVLETFRDNFAQGATLWKTTSQPG
DQLSYRFFSRLKMDTVGRAVDAGLLDGTHPTVPIVEDWSDLYGGTPVQSADFDAGRGMAK
TWLYFGGLRPAEDILSVPALPAPVQARLKDFLGLGLAHVRFAAVDWRHRSANVYFRGQGP
LDTAQFARVHALSGGTPPAADVVAEVLAYVPEDYCVAITLDLHTGAIDRVCFYALKVPKD
ARPRVPARIATFLEVAPSHDPEECNVIGWSFGRSGDYVKAERSYTGNMTEILSGWNCFFH
GEEGRDHDLRALQDTGSITGGAR
Reference
  Authors
Steffensky M, Muhlenweg A, Wang ZX, Li SM, Heide L
  Title
Identification of the novobiocin biosynthetic gene cluster of Streptomyces spheroides NCIB 11891.
  Journal
Antimicrob Agents Chemother 44:1214-22 (2000)
DOI:10.1128/AAC.44.5.1214-1222.2000
Reference
  Authors
Ozaki T, Mishima S, Nishiyama M, Kuzuyama T
  Title
NovQ is a prenyltransferase capable of catalyzing the addition of a dimethylallyl group to both phenylpropanoids and flavonoids.
  Journal
J Antibiot (Tokyo) 62:385-92 (2009)
DOI:10.1038/ja.2009.48

DBGET integrated database retrieval system