KEGG   Addendum: AAF70103
Entry
AAF70103          CDS       T10000                                 

Gene name
aknE1
Definition
(KEGG) bifunctional aromatase (cyclase/dehydratase)
  KO
K15884  bifunctional aromatase (cyclase/dehydratase) [EC:4.2.1.-]
Taxonomy
TAX:33899
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces galilaeus)
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc SnoaL_4 SnoaL_2
Other DBs
NCBI-ProteinID: AAF70103
GB: AF257324
UniProt: Q9L554
LinkDB
AA seq 450 aa
MAHEVHTTEHTITVAAAPEAVFGLVERAEDWPHVFPPSLHVEYLERSGEEERLRIWATAN
GEVKSWTSRRTLDRAGLRIRFRQEVSQDPVAAMGGEWIVEALPGGGSRVRLLHDFRAVDD
LERNVSWILEAIERNSGAELAALESAALRTGTDEAPYTFEDSVRIDAPAQDVRDFLHDAG
QWQERLPHVARVLLKEDTPDVQHLEMDTRTPDGSTHTTASVRICLPDGRITYKQLQTPAL
MSVHTGEWSVREIPSGCVAVSRHTVVVNAAAVTKVLGASATTADARTFIRDALGGNSTIT
MRHAKEYAQRRAATEPVPPAEYASVQRFYARQMRLLDEGEGDAWADTFTEDGTFDQSSFA
EPLRGRAAIAAAVRGRPAAPAGTVRRHWLGLPAAWRFPDGSVRTAYDALVVSTEAGAAPV
IRLSTSCQDVLVADGDGWLVSHRYVGHDGQ
Reference
  Authors
Raty K, Kantola J, Hautala A, Hakala J, Ylihonko K, Mantsala P
  Title
Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster.
  Journal
Gene 293:115-22 (2002)
DOI:10.1016/S0378-1119(02)00699-6

DBGET integrated database retrieval system