KEGG   Addendum: AAG29782
Entry
AAG29782          CDS       T10000                                 

Gene name
couJ
Definition
(KEGG) coumermycin A biosynthesis protein CouJ
  KO
K12703  novobiocin biosynthesis protein NovJ
Taxonomy
TAX:68264
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces rishiriensis)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 2-Hacid_dh_C K-cyclin_vir_C
Other DBs
NCBI-ProteinID: AAG29782
GB: AF235050
UniProt: Q9F8V0
LinkDB
AA seq 258 aa
MTGPAASAVACEPVAMVTGAGRGIGAATAERLAAEGMAVIVVDRVEQDTTATVSAIRAAG
GRASGLGCDVSVAQAVTATVASAVEEFGHLDVLVNCAGITQDRLLLTMSDQEWDRVLDVN
LGGSMRCSFAVGRHMRRQGHGRIINFSSVAARGNAGQTNYATAKGAIAGFTRTLAAEFGP
HGVTVNSIAPGFVATPMVAELTERLGVDRDTVLLEAAMSSAVGRIGTPEEIAAVVAFVTR
PESGYLTGETIHVEGGRR
Reference
  Authors
Wang ZX, Li SM, Heide L
  Title
Identification of the coumermycin A(1) biosynthetic gene cluster of Streptomyces rishiriensis DSM 40489.
  Journal
Antimicrob Agents Chemother 44:3040-8 (2000)
DOI:10.1128/AAC.44.11.3040-3048.2000
Reference
  Authors
Schmutz E, Muhlenweg A, Li SM, Heide L
  Title
Resistance genes of aminocoumarin producers: two type II topoisomerase genes confer resistance against coumermycin A1 and clorobiocin.
  Journal
Antimicrob Agents Chemother 47:869-77 (2003)
DOI:10.1128/AAC.47.3.869-877.2003

DBGET integrated database retrieval system