KEGG   Addendum: AAG29792
Entry
AAG29792          CDS       T10000                                 

Gene name
couN7
Definition
(KEGG) coumermycin A biosynthesis protein CouN7
  KO
K12724  clorobiocin/coumermycin A biosynthesis protein CloN7/CouN7
Taxonomy
TAX:68264
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces rishiriensis)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase
Other DBs
NCBI-ProteinID: AAG29792
GB: AF235050
UniProt: Q9F8U0
LinkDB
AA seq 281 aa
MANHGPVVYGLEVPGARLHYEIQGAGPLLVVVGLPMGCKGFAPISRPLAEHFTVVTFDPR
GVHSSPADDPNQDALPEVMADDVHRLISALDAGPAYLFASSGGGVTALALAAQHPDQVRT
LVAHEPPLLELLTDRVELRAAIDEICDMYRENRPAALQKYLALADIRLHRPTPDPPGPNA
FTAPWDVWTILDRLFRFTLRPTTRYRPDIDALRPMADRIVIAGGSKAQGSLFHRTAVALA
DQLGTELVDFPGDHTGFLTDSEPFARLLFEVFTKARSHNGP
Reference
  Authors
Wang ZX, Li SM, Heide L
  Title
Identification of the coumermycin A(1) biosynthetic gene cluster of Streptomyces rishiriensis DSM 40489.
  Journal
Antimicrob Agents Chemother 44:3040-8 (2000)
DOI:10.1128/AAC.44.11.3040-3048.2000

DBGET integrated database retrieval system