KEGG   Addendum: AAL78068Help
Entry
AAL78068          CDS       T10000                                 

Gene name
APDH
Definition
(KEGG) D-arabitol-phosphate dehydrogenase (EC:1.1.1.301)
  KO
K19648  D-arabitol-phosphate dehydrogenase [EC:1.1.1.301]
Taxonomy
TAX:33945
  Lineage
Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus
Organism
ag  Addendum (Enterococcus avium)
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2 DUF364 MoaE
Motif
Other DBs
NCBI-ProteinID: AAL78068
GB: AY078980
UniProt: Q8KQL2
LinkDB All DBs
AA seq 352 aa AA seqDB search
MSKTMKGVSKQAPGYDQMAFIDLSVPEATDDKVLIKVAYTGICGSDIHTFKGEYKNPTTP
VVLGHEFSGQVVEVGANVPKVKVGDRVTSETTFYVCGECDYCKEKQYNLCPHRKGIGTQQ
NGSMANYVLAREESIHLLPDHLSYEGAAMSEPLACCVHAMYQKSHLELKDTIIIMGPGPI
GLYLLQIAKEIGAFVIMTGITKDAHRLALAKKLGADVIVDTMKEDLAKVVNEITDGYGVD
KVYDASGAVPAVNASLPLIRKQGQFIQVGLFANKMVDLDTESIIQREIEYIGSRSQNPYD
WPIAIHLLAKGAINIDEMITKKYPLTEWREAFDKVMEGNEIKVMIESNPEEF
Reference
  Authors
Povelainen M, Eneyskaya EV, Kulminskaya AA, Ivanen DR, Kalkkinen N, Neustroev KN, Miasnikov AN
  Title
Biochemical and genetic characterization of a novel enzyme of pentitol metabolism: D-arabitol-phosphate dehydrogenase.
  Journal
Biochem J 371:191-7 (2003)
DOI:10.1042/BJ20021096

DBGET integrated database retrieval system