KEGG   Addendum: AAM94797
Entry
AAM94797          CDS       T10000                                 

Gene name
calS13
Definition
(KEGG) dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
  KO
K21328  dTDP-4-amino-4,6-dideoxy-D-glucose/dTDP-4-amino-2,4-dideoxy-beta-L-xylose transaminase [EC:2.6.1.33 2.6.1.-]
Taxonomy
TAX:1877
  Lineage
Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae; Micromonospora
Organism
ag  Addendum (Micromonospora echinospora)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1
Other DBs
NCBI-ProteinID: AAM94797
GB: AF497482
UniProt: Q8KND8
LinkDB
Structure
PDB: 
4ZAS

AA seq 376 aa
MIPLSKVAMSPDVSTRVSAVLSSGRLEHGPTVAEYEAAVGSRIGNPRVVSVNCGTAGLHL
ALSLAARPGAGESEHDGPGEVLTTPLTFEGTNWPILANGLRIRWVDVDPATLNMDLDDLA
AKISPATRAIVVVHWLGYPVDLNRLRAVVDRATAGYDRRPLVVEDCAQAWGATYRGAPLG
THGNVCVYSTGAIKILTTGSGGFVVLPDDDLYDRLRLRRWLGIERASDRITGDYDVAEWG
YRFILNEIGGAIGLSNLERVDELLRRHRENAAFYDKELAGIDGVEQTERADDREPAFWMY
PLKVRDRPAFMRRLLDAGIATSVVSRRNDAHSCVASARTTLPGLDRVADRVVHIPVGWWL
TEDDRSHVVETIKSGW
Reference
  Authors
Ahlert J, Shepard E, Lomovskaya N, Zazopoulos E, Staffa A, Bachmann BO, Huang K, Fonstein L, Czisny A, Whitwam RE, Farnet CM, Thorson JS
  Title
The calicheamicin gene cluster and its iterative type I enediyne PKS.
  Journal
Science 297:1173-6 (2002)
DOI:10.1126/science.1072105

DBGET integrated database retrieval system