KEGG   Addendum: AAN65226
Entry
AAN65226          CDS       T10000                                 

Gene name
cloJ
Definition
(KEGG) clorobiocin biosynthesis protein CloJ
  KO
K12703  novobiocin biosynthesis protein NovJ
Taxonomy
TAX:285450
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces roseochromogenus)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 2-Hacid_dh_C OMPdecase
Other DBs
NCBI-ProteinID: AAN65226
GB: AF329398
UniProt: Q8GHC5
LinkDB
AA seq 258 aa
MTGPAGSPVAYEPVAMVTGAGRGIGAATAERLAAEGMAVIVVDRAEQDTTATVSAIRAAG
GRARGIGCDVAVAHAVTAAVASAVEEFGHVDVLVNCAGVNQDRLLLTMSDQEWDTVLDVN
LGGTMRCSFAVGRHMCRQGHGRIINFSSVAARGNAGQTNYATAKGAIAGFTRTLAAELGP
HGVTVNAIAPGFVATPMVDELIERLGVDRDTALLEAAMSSAVGRIGTPEEIAAAVAFVTR
QESGYLTGETIHVEGGRR
Reference
  Authors
Pojer F, Li SM, Heide L.
  Title
Molecular cloning and sequence analysis of the clorobiocin biosynthetic gene cluster: new insights into the biosynthesis of aminocoumarin antibiotics.
  Journal
Microbiology 148:3901-11 (2002)
DOI:10.1099/00221287-148-12-3901

DBGET integrated database retrieval system