KEGG   Addendum: AAN65230
Entry
AAN65230          CDS       T10000                                 

Gene name
cloN1
Definition
(KEGG) clorobiocin biosynthesis protein CloN1
  KO
K17626  clorobiocin biosynthesis protein CloN1
Taxonomy
TAX:285450
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces roseochromogenus)
SSDB
Motif
Pfam: PP-binding
Other DBs
NCBI-ProteinID: AAN65230
GB: AF329398
UniProt: Q8GHC1
LinkDB
AA seq 95 aa
MVSGPTELEHVLTRLEILLNDVWDQRPAGAATSATAPLVSLGVDSLTLALLLDKVGREFH
IDWTADTPPGAASSLRSIADLVLRRDGGGATAAEA
Reference
  Authors
Pojer F, Li SM, Heide L.
  Title
Molecular cloning and sequence analysis of the clorobiocin biosynthetic gene cluster: new insights into the biosynthesis of aminocoumarin antibiotics.
  Journal
Microbiology 148:3901-11 (2002)
DOI:10.1099/00221287-148-12-3901

DBGET integrated database retrieval system