KEGG   Addendum: AAN65231
Entry
AAN65231          CDS       T10000                                 

Gene name
cloN2
Definition
(KEGG) clorobiocin biosynthesis protein CloN2
  KO
K12723  clorobiocin biosynthesis protein CloN2
Taxonomy
TAX:285450
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces roseochromogenus)
SSDB
Motif
Pfam: ACP_syn_III_C ACP_syn_III Chal_sti_synt_N Ketoacyl-synt_C
Other DBs
NCBI-ProteinID: AAN65231
GB: AF329398
UniProt: Q8GHC0
LinkDB
AA seq 355 aa
MRTSGIYVAGIGVFRPKTESVDVAVRQGLVSKYAADASGITGVAVAGDVSPPEIALIAAQ
QALKSSGLSADDIGLLLCTGVWHQGPDGWGPQYFLQRHLLGDDLLAVELRHGCNGTFSAL
ELAVPYLRSAPHVGGALITASDNFGTPLIDRWNPGEGLAFLGDGAGAVVLGTSPGFAELL
SICTASFSGMEEVHRAGEPLFPPGATTGTFLDYGARAARFQQKATDDGTWVQFLLGHQKH
NLECVEQALHEAGVDARDIKTVVIHSMPRQAAASYLKILGFSLESSTWEFSRTTGHLGAG
DHLAALHHLLSTGKVGPGDNLLLCGSSPGVTYKAAVIRILDTAALRNQEARPDGL
Reference
  Authors
Pojer F, Li SM, Heide L.
  Title
Molecular cloning and sequence analysis of the clorobiocin biosynthetic gene cluster: new insights into the biosynthesis of aminocoumarin antibiotics.
  Journal
Microbiology 148:3901-11 (2002)
DOI:10.1099/00221287-148-12-3901

DBGET integrated database retrieval system