KEGG   Addendum: AAN65233
Entry
AAN65233          CDS       T10000                                 

Gene name
cloN4
Definition
(KEGG) clorobiocin biosynthesis protein CloN4
  KO
K12719  L-proline---[L-prolyl-carrier protein] ligase [EC:6.2.1.53]
Taxonomy
TAX:285450
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces roseochromogenus)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AAN65233
GB: AF329398
UniProt: Q8GHB8
LinkDB
AA seq 501 aa
MSDRRGLHDLLAASAARTPNAPAVIGPAGSMSYGELDERANDLAGRLSGRGIEKGDRVLI
WSPKSANAIAAMQAVLRLGAIYIPVDPLTPPERFAAIARESGALALCAPDDLSARVPSPL
RDRLACVDLDAAPVPNALPTAPVNTRVEPDDLAYILYTSGSTGTPKGVCVSHRSALAFID
WAVAELAPGPQDRFANHSGLSFDLSVLDLYAAFTVGAAVCPIHAEFAYAPERLVEFLHRE
RISVWYSVPSVLILMLRDGGLLDRPAPETLRALLFAGEPFPIGYVRALAAWSDARLLNLY
GPTETNVCTYHEVRPADLARDLPVPIGRPCSGDRVWARRPDGSEAEPGEEGELVVSGPTV
FAGYWGRQPQEGPYATGDRVKVRPDGSFDYLGRHDDMVKIRGHRIELGDVVAALNSHPGV
AEAAVVAVGEGLDRNLAAFVIRSQGSSFGNVALRRHLADRLAPHMIPGDIRFVDQLPHND
RGKLDLAALQIPLHGAQKVQG
Reference
  Authors
Pojer F, Li SM, Heide L.
  Title
Molecular cloning and sequence analysis of the clorobiocin biosynthetic gene cluster: new insights into the biosynthesis of aminocoumarin antibiotics.
  Journal
Microbiology 148:3901-11 (2002)
DOI:10.1099/00221287-148-12-3901

DBGET integrated database retrieval system