| Entry |
|
|---|
| Gene name |
cloN5
|
|---|
| Definition |
(KEGG) clorobiocin biosynthesis protein CloN5
|
|---|
| KO |
| K12720 | peptidyl carrier protein |
|
|---|
| Taxonomy |
|
|---|
| Lineage |
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces |
|---|
| Organism |
ag Addendum (Streptomyces roseochromogenus)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| AA seq |
89 aa
MTTQTREDISSELLTFIRESFLAGDPEGELDADTPLLELGILNSLNTATLIAHLGERFGV
HVPLMDVTATTFKSVRTLSEIVHESLSRK |
|---|
| Reference |
|
|---|
| Authors |
Pojer F, Li SM, Heide L. |
|---|
| Title |
Molecular cloning and sequence analysis of the clorobiocin biosynthetic gene cluster: new insights into the biosynthesis of aminocoumarin antibiotics. |
|---|
| Journal |
|
|---|
