KEGG   Addendum: AAN65236
Entry
AAN65236          CDS       T10000                                 

Gene name
cloN7
Definition
(KEGG) clorobiocin biosynthesis protein CloN7
  KO
K12724  clorobiocin/coumermycin A biosynthesis protein CloN7/CouN7
Taxonomy
TAX:285450
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces roseochromogenus)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase_PHB Esterase Peptidase_S9 Thioesterase Peptidase_S15
Other DBs
NCBI-ProteinID: AAN65236
GB: AF329398
UniProt: Q8GHB5
LinkDB
AA seq 278 aa
MANDKPVVQSLKVPGARLHYEIQGAGPLLVVVGLPMGCKGFAPISQLLAEHFTVVTFDPR
GVIGSPLEDPTQEAEPELMADDVHRLISTLDAGPVYLFGSSGGAVTALVLAAQHPEQVRA
LVAHEPPLLELLIDREQMRAAIDEICDLYRENRPVALQKYLALANIRLHRPAQQPPEPNS
FTDPEDVWTILDRLFHHTLRPTTRYRPDINALRPMGDRIVIAGGSTAEGSLFHRTAVALA
DQLGTKLVEFPGDHTGFLTESESFAQLLFEVLTNARPA
Reference
  Authors
Pojer F, Li SM, Heide L.
  Title
Molecular cloning and sequence analysis of the clorobiocin biosynthetic gene cluster: new insights into the biosynthesis of aminocoumarin antibiotics.
  Journal
Microbiology 148:3901-11 (2002)
DOI:10.1099/00221287-148-12-3901

DBGET integrated database retrieval system