KEGG   Addendum: AAN65239
Entry
AAN65239          CDS       T10000                                 

Gene name
cloQ
Definition
(KEGG) 4-hydroxyphenylpyruvate 3-dimethylallyltransferase (EC:2.5.1.111)
  KO
K12707  4-hydroxyphenylpyruvate 3-dimethylallyltransferase [EC:2.5.1.111]
Taxonomy
TAX:285450
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces roseochromogenus)
SSDB
Motif
Pfam: PTase_Orf2
Other DBs
NCBI-ProteinID: AAN65239
GB: AF329398
UniProt: Q8GHB2
LinkDB
Structure
PDB: 
2XM5 2XM7 2XLQ 2XLY

AA seq 324 aa
MPALPIDQEFDCERFRADIRATAAAIGAPIAHRLTDTVLEAFRDNFAQGATLWKTTSQPG
DQLSYRFFSRLKMDTVSRAIDAGLLDAAHPTLAVVDAWSSLYGGAPVQSGDFDAGRGMAK
TWLYFGGLRPAEDILTVPALPASVQARLKDFLALGLAHVRFAAVDWRHHSANVYFRGKGP
LDTVQFARIHALSGSTPPAAHVVEEVLAYMPEDYCVAITLDLHSGDIERVCFYALKVPKN
ALPRIPTRIARFLEVAPSHDVEECNVIGWSFGRSGDYVKAERSYTGNMAEILAGWNCFFH
GEEGRDHDLRALHQHTESTMGGAR
Reference
  Authors
Pojer F, Li SM, Heide L.
  Title
Molecular cloning and sequence analysis of the clorobiocin biosynthetic gene cluster: new insights into the biosynthesis of aminocoumarin antibiotics.
  Journal
Microbiology 148:3901-11 (2002)
DOI:10.1099/00221287-148-12-3901
Reference
  Authors
Metzger U, Keller S, Stevenson CE, Heide L, Lawson DM
  Title
Structure and mechanism of the magnesium-independent aromatic prenyltransferase CloQ from the clorobiocin biosynthetic pathway.
  Journal
J Mol Biol 404:611-26 (2010)
DOI:10.1016/j.jmb.2010.09.067

DBGET integrated database retrieval system