KEGG   Addendum: AAR97958
Entry
AAR97958          CDS       T10000                                 

Gene name
vioA
Definition
(KEGG) dTDP-4-amino-4,6-dideoxy-D-glucose transaminase (EC:2.6.1.33)
  KO
K20429  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Taxonomy
TAX:622
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Shigella
Organism
ag  Addendum (Shigella dysenteriae)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_5 SelA
Other DBs
NCBI-ProteinID: AAR97958
GB: AY380835
UniProt: Q6U1I3
LinkDB
AA seq 367 aa
MEKPIFVTQPNLPPLEEFIPYLEIIWQNKQFTNNGPMHQKLEKKLCEFLGVEYISLFNNG
TIALITAVQALGVKGEVITTPYSFVATAHSLVLNGLKPVFVDIDPKTLNIDPRRIEEAIT
PETQAIMPVHCYGNPCDTQAIADIAQKYNLKVIYDAAHAFGVEDDDGSVLRHGDLSVLSF
HATKVFSTFEGGAIVCNSKEMKEKIDRLKNFGYIDETNINIIGSNGKMSEVNAAFGLLQL
EHMDTFLRGRMNADMFYRQKLKDITGISIVIPSGQKISNFSYFPILVESDFPLSRDELFN
YLKNQNIFARRYFYPVIPDFQAYLNVGEVCDVKNAREIASKVLCLPMHAELSSDILEYIV
STIREIK
Reference
  Authors
Feng L, Tao J, Guo H, Xu J, Li Y, Rezwan F, Reeves P, Wang L
  Title
Structure of the Shigella dysenteriae 7 O antigen gene cluster and identification of its antigen specific genes.
  Journal
Microb Pathog 36:109-15 (2004)
DOI:10.1016/j.micpath.2003.10.003
Reference
  Authors
Wang Y, Xu Y, Perepelov AV, Qi Y, Knirel YA, Wang L, Feng L
  Title
Biochemical characterization of dTDP-D-Qui4N and dTDP-D-Qui4NAc biosynthetic pathways in Shigella dysenteriae type 7 and Escherichia coli O7.
  Journal
J Bacteriol 189:8626-35 (2007)
DOI:10.1128/JB.00777-07

DBGET integrated database retrieval system