KEGG   Addendum: AAU00081
Entry
AAU00081          CDS       T10000                                 

Gene name
phpF
Definition
(KEGG) phosphinothricin biosynthesis protein PhpF
  KO
K12908  phosphonoformate cytidylyltransferase [EC:2.7.7.93]
Taxonomy
TAX:1938
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces viridochromogenes)
SSDB
Motif
Pfam: CTP_transf_like
Other DBs
NCBI-ProteinID: AAU00081
GB: AY632421
UniProt: Q5IW36
LinkDB
AA seq 184 aa
MSAEQIAGTGVIHGRFQPLHLGHLEYLLAGAERCRTLVVGITNPDPWTTTEETTDPERGL
PESNPCTFYERYLMVEGALTEAGVSHERLRIVPFPHSFPERLAHYAPADARYFVTVYDDW
GDAKLDRFHALGLRTEVMWRRTDKPVSGGRVRRSIAEGQPWEHLVPPAVARVVKECGIDE
RIRA
Reference
  Authors
Blodgett JA, Zhang JK, Metcalf WW
  Title
Molecular cloning, sequence analysis, and heterologous expression of the phosphinothricin tripeptide biosynthetic gene cluster from Streptomyces viridochromogenes DSM 40736.
  Journal
Antimicrob Agents Chemother 49:230-40 (2005)
DOI:10.1128/AAC.49.1.230-240.2005
Reference
  Authors
Blodgett JA, Thomas PM, Li G, Velasquez JE, van der Donk WA, Kelleher NL, Metcalf WW
  Title
Unusual transformations in the biosynthesis of the antibiotic phosphinothricin tripeptide.
  Journal
Nat Chem Biol 3:480-5 (2007)
DOI:10.1038/nchembio.2007.9

DBGET integrated database retrieval system