KEGG   Addendum: AAZ78237Help
Entry
AAZ78237          CDS       T10000                                 

Gene name
mpdB
Definition
(KEGG) 2-methyl-1,2-propanediol dehydrogenase (EC:1.1.1.400)
  KO
K20927  2-methyl-1,2-propanediol dehydrogenase [EC:1.1.1.400]
Taxonomy
TAX:39687
  Lineage
Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae; Mycolicibacterium
Organism
ag  Addendum (Mycolicibacterium austroafricanum)
SSDB OrthologParalogGFIT
Motif
Pfam: GMC_oxred_C FAD_binding_2 GMC_oxred_N DAO Pyr_redox_2 FAD_binding_3 NAD_binding_8 Lycopene_cycl GidB FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AAZ78237
GB: DQ147773
UniProt: Q3YAT3
LinkDB All DBs
AA seq 552 aa AA seqDB search
MTTSADQTDVLVIGSGPGGAGVTLKLVQAGYKVTCLEQGPWVTPPEHPHYHREWEIEKQR
GWAYDPNVRGLPEDYPVTGFTTPYLMNNVGGSTMHYAGHWPRYKPVDFRKGTEHGLEGTI
DWPISYEELAPYYDENDAIYGISGMVGDPSYPDRTGVDRDPPVKPGKLGRNFAQALGDLG
WHWWPSDNAIITRPREGREADIAAGNELSGSPTGSLSTPTHTHWPTAIALGADLRTHARV
EQIHTKNGKATGATYIDTRTGARHEINAKIVVVSASGIGTPRLLLMSAQKGHPDGLANSN
GLVGKYLMHHILRVLASVVRTSRMEGYKGAFGAPLYSHEFYHTDTNRGFVNGFGMQVARS
FGAAYTAMGSHTGYVAPWGKSHRKFFNEHFGNHLMVFMFGEDLPVETNCVTLDPDAKDSS
GLPAARVNWEPHENDIALANYGIDRIFEAARALGAVETNDTGVLNPPPGWHLMGTCRMGN
NPEDSVTNKWHQTWDVPNLFVVDGSSLTTGGAVNPTSTIGALAVRAGDYISRRFSDIVDQ
RTTPSNEDAPAI
Reference
  Authors
Lopes Ferreira N, Labbe D, Monot F, Fayolle-Guichard F, Greer CW
  Title
Genes involved in the methyl tert-butyl ether (MTBE) metabolic pathway of Mycobacterium austroafricanum IFP 2012.
  Journal
Microbiology 152:1361-74 (2006)
DOI:10.1099/mic.0.28585-0

DBGET integrated database retrieval system