KEGG   Addendum: ABB82944Help
Entry
ABB82944          CDS       T10000                                 

Gene name
CYP71AV1
Definition
(KEGG) amorpha-4,11-diene 12-monooxygenase (EC:1.14.14.114)
  KO
K21716  amorpha-4,11-diene 12-monooxygenase [EC:1.14.14.114]
Taxonomy
TAX:35608
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Organism
ag  Addendum (Artemisia annua)
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Cactin_mid
Motif
Other DBs
NCBI-ProteinID: ABB82944
GB: DQ268763
UniProt: Q1PS23
LinkDB All DBs
AA seq 495 aa AA seqDB search
MKSILKAMALSLTTSIALATILLFVYKFATRSKSTKKSLPEPWRLPIIGHMHHLIGTTPH
RGVRDLARKYGSLMHLQLGEVPTIVVSSPKWAKEILTTYDITFANRPETLTGEIVLYHNT
DVVLAPYGEYWRQLRKICTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSEN
VFKLIATILSRAAFGKGIKDQKELTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARL
TSLRKKIDNLIDNLVAEHTVNTSSKTNETLLDVLLRLKDSAEFPLTSDNIKAIILDMFGA
GTDTSSSTIEWAISELIKCPKAMEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLR
LHPPLPLVLPRECRQPVNLAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSA
TVMGAEYEYLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSG
ATMQRKTELLLVPSF
Reference
  Authors
Teoh KH, Polichuk DR, Reed DW, Nowak G, Covello PS
  Title
Artemisia annua L. (Asteraceae) trichome-specific cDNAs reveal CYP71AV1, a cytochrome P450 with a key role in the biosynthesis of the antimalarial sesquiterpene lactone artemisinin.
  Journal
FEBS Lett 580:1411-6 (2006)
DOI:10.1016/j.febslet.2006.01.065

DBGET integrated database retrieval system