KEGG   Addendum: ABC02793
Entry
ABC02793          CDS       T10000                                 

Gene name
atmS13
Definition
(KEGG) dTDP-2-deoxy-4-keto-beta-L-xylose 4-aminotransferase
  KO
K21328  dTDP-4-amino-4,6-dideoxy-D-glucose/dTDP-4-amino-2,4-dideoxy-beta-L-xylose transaminase [EC:2.6.1.33 2.6.1.-]
Taxonomy
TAX:360723
  Lineage
Bacteria; Actinobacteria; Streptosporangiales; Thermomonosporaceae; Actinomadura
Organism
ag  Addendum (Actinomadura melliaura)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Other DBs
NCBI-ProteinID: ABC02793
GB: DQ297453
UniProt: Q0H2X1
LinkDB
Structure
PDB: 
4ZWV 4XAU

AA seq 369 aa
MIPLFKVAVSPTALDRVAEVFASGYLGQGPRVAEFESALAARLGNPRVVSVHSGTSGLCL
ALRLLDAPEERDEVLSTPLTFEATNWAILADGRRITWVDVDPATLTMDLDDLERKISPAT
RAIIVVHWTGYPVDLDRLAGILDRAEREHGFRPAVIEDCAHAWGASYRGVPLGSHGNMCV
FSFQALKHLTCGDGGLLTLPGDELHERAMLRRFYGIDRTADRLRGAYDVAEWGLKWHMTD
LNAAIGLANLETVDEQLRLHRENAAFYDKELTGVPGLELLQRSPDREGSFYVYDVKVDDR
PAFHRKMEAAGIMAGLVSRRNDEHSCVAHLRTSLPGLDSVYDRMVSLPVGWWLTEQDREH
VVATIRSGW
Reference
  Authors
Gao Q, Zhang C, Blanchard S, Thorson JS
  Title
Deciphering indolocarbazole and enediyne aminodideoxypentose biosynthesis through comparative genomics: insights from the AT2433 biosynthetic locus.
  Journal
Chem Biol 13:733-43 (2006)
DOI:10.1016/j.chembiol.2006.05.009

DBGET integrated database retrieval system