KEGG   Addendum: ABD17321
Entry
ABD17321          CDS       T10000                                 

Gene name
EGS1
Definition
(KEGG) eugenol synthase (EC:1.1.1.318)
  KO
K17055  eugenol synthase [EC:1.1.1.318]
Taxonomy
TAX:39350
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Organism
ag  Addendum (Ocimum basilicum)
SSDB
Motif
Pfam: NmrA NAD_binding_10 Epimerase GDP_Man_Dehyd 3Beta_HSD Sacchrp_dh_NADP AlaDh_PNT_C NAD_binding_2 adh_short Polysacc_synt_2 Semialdhyde_dh
Other DBs
NCBI-ProteinID: ABD17321
GB: DQ372812
UniProt: Q15GI4
LinkDB
Structure
PDB: 

AA seq 314 aa
MEENGMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVK
GELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRIN
ALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEA
KFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVP
EEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLD
IFVHDPPPPASAAF
Reference
  Authors
Koeduka T, Fridman E, Gang DR, Vassao DG, Jackson BL, Kish CM, Orlova I, Spassova SM, Lewis NG, Noel JP, Baiga TJ, Dudareva N, Pichersky E
  Title
Eugenol and isoeugenol, characteristic aromatic constituents of spices, are biosynthesized via reduction of a coniferyl alcohol ester.
  Journal
Proc Natl Acad Sci U S A 103:10128-33 (2006)
DOI:10.1073/pnas.0603732103
Reference
  Authors
Louie GV, Baiga TJ, Bowman ME, Koeduka T, Taylor JH, Spassova SM, Pichersky E, Noel JP
  Title
Structure and reaction mechanism of basil eugenol synthase.
  Journal
PLoS One 2:e993 (2007)
DOI:10.1371/journal.pone.0000993

DBGET integrated database retrieval system