KEGG   Addendum: ABD17322
Entry
ABD17322          CDS       T10000                                 

Gene name
IGS1
Definition
(KEGG) isoeugenol synthase (EC:1.1.1.319)
  KO
K17056  isoeugenol synthase [EC:1.1.1.319]
Taxonomy
TAX:4102
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Organism
ag  Addendum (Petunia x hybrida)
SSDB
Motif
Pfam: NmrA NAD_binding_10 Epimerase 3Beta_HSD GDP_Man_Dehyd Semialdhyde_dh AlaDh_PNT_C KR
Other DBs
NCBI-ProteinID: ABD17322
GB: DQ372813
UniProt: Q15GI3
LinkDB
AA seq 323 aa
MTTGKGKILILGATGYLGKYMVKASISLGHPTYAYVMPLKKNSDDSKLQLLKEFESLGVT
IFYGELSEHDKLVAVFKEVDIVISTLAVPQYLEQLKVIEAIKEAGNIKRFVPSEFGNEVD
RVRALPRFQAVLDNKKKIRRATEAAGIPFTFVSANSLTAYFVDYLLHPRQKSEQVTIYGS
GDAKAVLNYEEDVAAYTIKAADDPRAANRVLIIKPPKNIVSQLDLVSSWEKTTGSTLKMT
HISEQEIIKLSESINFPENIHASILHNIFIAGAQLSFELTQDHDLEASELYPNYNYTSVD
EYLKICLVNPPKPKLATYAQPST
Reference
  Authors
Koeduka T, Fridman E, Gang DR, Vassao DG, Jackson BL, Kish CM, Orlova I, Spassova SM, Lewis NG, Noel JP, Baiga TJ, Dudareva N, Pichersky E
  Title
Eugenol and isoeugenol, characteristic aromatic constituents of spices, are biosynthesized via reduction of a coniferyl alcohol ester.
  Journal
Proc Natl Acad Sci U S A 103:10128-33 (2006)
DOI:10.1073/pnas.0603732103

DBGET integrated database retrieval system