KEGG   Addendum: ABD64512
Entry
ABD64512          CDS       T10000                                 

Gene name
hbzF
Definition
(KEGG) maleylpyruvate hydrolase (EC:3.7.1.23)
  KO
K20758  maleylpyruvate hydrolase [EC:3.7.1.23]
Taxonomy
TAX:43263
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas
Organism
ag  Addendum (Pseudomonas alcaligenes)
SSDB
Motif
Pfam: FAA_hydrolase DUF2437
Other DBs
NCBI-ProteinID: ABD64512
GB: DQ394580
UniProt: Q0QFQ3
LinkDB
AA seq 287 aa
MKICRFNENRLGVVDGDEVLDVTEALSVLPSYEYPLPGYDPLIKHLDALLARIETLIKDA
PRILLADVRLLSPVANPGKIIAAPINYTRHLQEVLADSAINNGVASFTQHIKKSGLFLKA
NSSLAGAGEGVALSHQDRRNDHEVELAIVIGKTARNVPREKSLEYVAGYCIGIDMTVRGP
EERSFRKSPDSYTILGPWLVTRDEIDSPGELQMSLKVNGEVRQNANTSDLILGVEELVEF
ASSFYTLHPGDVIISGTPEGVGPVNPGDAMLAEIERIGTMTIAIRSV
Comment
Unpublished sequence data: Zhao B, Tan CL, Yeo CC, Dong YH, Zhang LH, Poh CL (2006).
Reference
  Authors
Liu K, Liu TT, Zhou NY
  Title
HbzF catalyzes direct hydrolysis of maleylpyruvate in the gentisate pathway of Pseudomonas alcaligenes NCIMB 9867.
  Journal
Appl Environ Microbiol 79:1044-7 (2013)
DOI:10.1128/AEM.02931-12

DBGET integrated database retrieval system