KEGG   Addendum: ABD90685
Entry
ABD90685          CDS       T10000                                 

Gene name
XMT
Definition
(KEGG) 7-methylxanthosine synthase
  KO
K12729  7-methylxanthosine synthase [EC:2.1.1.158]
Taxonomy
TAX:49390
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Gardenieae complex; Bertiereae - Coffeeae clade; Coffeeae; Coffea
Organism
ag  Addendum (Coffea canephora)
SSDB
Motif
Pfam: Methyltransf_7
Other DBs
NCBI-ProteinID: ABD90685
GB: DQ422954
UniProt: A4GE69
LinkDB
Structure
PDB: 
2EG5

AA seq 372 aa
MELQEVLRMNGGEGDTSYAKNSAYNQLVLAKVKPVLEQCVRELLRANLPNINKCIKVADL
GCASGPNTLLTVRDIVQSIDKVGQEKKNELERPTIQIFLNDLFPNDFNSVFKLLPSFYRK
LEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLQWLSQVPSGLVTELGIGTNK
GSIYSSKASRLPVQKAYLDQFTKDFTTFLRIHSEELFSHGRMLLTCICKGVELDARNAID
LLEMAINDLVVEGHLEEEKLDSFNLPVYIPSAEEVKCIVEEEGSFEILYLETFKVLYDAG
FSIDDEHIKAEYVASSVRAVYEPILASHFGEAIIPDIFHRFAKHAAKVLPLGKGFYNNLI
ISLAKKPEKSDM
Reference
  Authors
McCarthy AA, Biget L, Lin C, Petiard V, Tanksley SD, McCarthy JG
  Title
Cloning, expression, crystallization and preliminary X-ray analysis of the XMT and DXMT N-methyltransferases from Coffea canephora (robusta).
  Journal
Acta Crystallogr Sect F Struct Biol Cryst Commun 63:304-7 (2007)
DOI:10.1107/S1744309107009268
Reference
  Authors
McCarthy AA, McCarthy JG
  Title
The structure of two N-methyltransferases from the caffeine biosynthetic pathway.
  Journal
Plant Physiol 144:879-89 (2007)
DOI:10.1104/pp.106.094854

DBGET integrated database retrieval system