KEGG   Addendum: ABQ44578
Entry
ABQ44578          CDS       T10000                                 

Gene name
fcbB
Definition
(KEGG) 4-chlorobenzoyl-CoA dehalogenase
  KO
K14418  4-chlorobenzoyl-CoA dehalogenase [EC:3.8.1.7]
Taxonomy
TAX:72586
  Lineage
Bacteria; Proteobacteria
Organism
ag  Addendum (Pseudomonas sp. CBS3)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ABQ44578
GB: EF569604
UniProt: A5JTM5
LinkDB
Structure
PDB: 
1NZY 1JXZ

AA seq 269 aa
MYEAIGHRVEDGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAF
CAGFYLREIPLDKGVAGVRDHFRIGALWWHQMIHKIIRVKRPVLAAINGVAAGGGLGISL
ASDMAICADSAKFVCAWHTIGIGNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWG
LVSRVYPKDDFREVAWKVARELAAAPTHLQVMAKERFHAGWMQPVEECTEFEIQNVIASV
THPHFMPCLTEFLDGHRADRPQVELPAGV
Reference
PMID:1610806
  Authors
Chang KH, Liang PH, Beck W, Scholten JD, Dunaway-Mariano D
  Title
Isolation and characterization of the three polypeptide components of 4-chlorobenzoate dehalogenase from Pseudomonas sp. strain CBS-3.
  Journal
Biochemistry 31:5605-10 (1992)
DOI:10.1021/bi00139a025

DBGET integrated database retrieval system