KEGG   Addendum: ABW91151
Entry
ABW91151          CDS       T10000                                 

Gene name
angMI
Definition
(KEGG) N,N-dimethyltransferase
  KO
K13332  N,N-dimethyltransferase
Taxonomy
TAX:42237
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces eurythermus)
Module
42237_M00803  dTDP-D-angolosamine biosynthesis
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 NodS Ubie_methyltran CMAS Methyltransf_15
Other DBs
NCBI-ProteinID: ABW91151
GB: EU232693
UniProt: A8WDM8
LinkDB
AA seq 240 aa
MNLEYSGDIARLYDLVHQGKGKDYRAEAEELAALVTQRRPGARSLLDVACGTGMHLRHLG
DLFEEVAGVEMSPDMLAIAQRRNPEAGIHRGDMRDFALGRRFDAVICMFSSIGHMRDQRE
LDAAIGRFAAHLPSGGVVIVDPWWFPETFTPGYVGASLVEAEGRTIARFSHSALEDGATR
IDVDYLVGVPGEGVRHLKETHRITLFGRAQYEAAFTAAGMSVEYLPHAATDRGLFVGVQA
Reference
  Authors
Schell U, Haydock SF, Kaja AL, Carletti I, Lill RE, Read E, Sheehan LS, Low L, Fernandez MJ, Grolle F, McArthur HA, Sheridan RM, Leadlay PF, Wilkinson B, Gaisser S
  Title
Engineered biosynthesis of hybrid macrolide polyketides containing D-angolosamine and D-mycaminose moieties.
  Journal
Org Biomol Chem 6:3315-27 (2008)
DOI:10.1039/b807914e

DBGET integrated database retrieval system