KEGG   Addendum: ABY83145
Entry
ABY83145          CDS       T10000                                 

Gene name
AziB1
Definition
(KEGG) 5-methyl-1-naphthoate 3-hydroxylase (EC:1.14.13.189)
  KO
K21376  5-methyl-1-naphthoate 3-hydroxylase [EC:1.14.13.189]
Taxonomy
TAX:285525
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces sahachiroi)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: ABY83145
GB: EU240558
UniProt: B4XY99
LinkDB
AA seq 401 aa
MTTEAADATDRLVTAFDHHDPGYTPRTAERINTEIRERGVTWSPAYGGIWILSRYADVRA
ALTDWRTYSSARGVHFPRAEGMPMFSPIDYDPPAQRGIRERMAAPMTGDAVSAMVPELRR
MVARLLAPLAGRGHGDLMAEFAEPFAIEVLGVAFGLSESCRARIREATRTMWTYISADRD
ASKFWPAFHALLAEEVERVRDEPDGSYLARLAAMRRDGSPLPDEELYSIIVSFCVAGHDN
TMNSITRLVHTLAQDPALQLRLRREPELRPAVAEEALRRWCPTDRFTRVTTREVTVAGTV
IPAGARVVLLFDAANRDPEKFPDPDTFDPDRGNSHQHLSFGHGIHHCMGVHLARAEFAAV
LDELSRLPLFDLEQPSDLHFENGRHIMFDRVSVRFRTGEEH
Reference
  Authors
Zhao Q, He Q, Ding W, Tang M, Kang Q, Yu Y, Deng W, Zhang Q, Fang J, Tang G, Liu W
  Title
Characterization of the azinomycin B biosynthetic gene cluster revealing a different iterative type I polyketide synthase for naphthoate biosynthesis.
  Journal
Chem Biol 15:693-705 (2008)
DOI:10.1016/j.chembiol.2008.05.021
Reference
  Authors
Ding W, Deng W, Tang M, Zhang Q, Tang G, Bi Y, Liu W
  Title
Biosynthesis of 3-methoxy-5-methyl naphthoic acid and its incorporation into the antitumor antibiotic azinomycin B.
  Journal
Mol Biosyst 6:1071-81 (2010)
DOI:10.1039/b926358f

DBGET integrated database retrieval system