KEGG   Addendum: ADB04296
Entry
ADB04296          CDS       T10000                                 

Gene name
nmsB
Definition
(KEGG) naphthyl-2-methylsuccinate synthase beta subunit
  KO
K15567  naphthyl-2-methylsuccinate synthase beta subunit [EC:4.1.99.-]
Taxonomy
TAX:700510
  Lineage
Bacteria; environmental samples
Organism
ag  Addendum (bacterium enrichment culture clone N47)
SSDB
Motif
Pfam: BssB_TutG
Other DBs
NCBI-ProteinID: ADB04296
GB: GU080099
UniProt: D2XBH7
LinkDB
AA seq 73 aa
MADTCRKCRWSRVDTGNPMKGVCFFGRRDGSAGESASGVSSTIIKGKLVNLSDKACENFE
PKPSHAQQIREGI
Comment
Incomplete sequence.
Reference
  Authors
Selesi D, Jehmlich N, von Bergen M, Schmidt F, Rattei T, Tischler P, Lueders T, Meckenstock RU
  Title
Combined genomic and proteomic approaches identify gene clusters involved in anaerobic 2-methylnaphthalene degradation in the sulfate-reducing enrichment culture N47.
  Journal
J Bacteriol 192:295-306 (2010)
DOI:10.1128/JB.00874-09

DBGET integrated database retrieval system