KEGG   Addendum: ADB04297
Entry
ADB04297          CDS       T10000                                 

Gene name
nmsA
Definition
(KEGG) naphthyl-2-methylsuccinate synthase alpha subunit
  KO
K01670  naphthyl-2-methylsuccinate synthase alpha subunit [EC:4.1.99.-]
Taxonomy
TAX:700510
  Lineage
Bacteria; environmental samples
Organism
ag  Addendum (bacterium enrichment culture clone N47)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ADB04297
GB: GU080100
UniProt: D2XBH8
LinkDB
AA seq 847 aa
ISTLLNREALKVSYWKEVKMQKNVALNICEETPGSTGRVQFLYDRCRWKHVAGGMYMRPE
VKVGIARARLLTEAYKETRGESEMIRRAKGLDHILENYPIFINDDELIVGDAGENPDTLA
IFPEMGFFPTIDIVEDPELMNDDIRDEARDIAEWWKPMGLQDKCMPYYDPHEIDISTPWT
IVDVPPFVANYMSVCPAYMSVLEDGLLGRIKTCEENIAKAFVKLRAYPWNGPENMPLMDK
IDVWRSMIVADKAVIKWARRYSRLAKIIAENFDLSDSVLGAEKRKNELLEISDICQRMPA
EPAKGFKDAMQSKWFVYLVCHSLERYSSGYAHLEDRLMWPYYKASVIDSTAQPMTREDAI
ELIECERLKVGERGVAKGRAHREGQPGANDLHIITLGGLDEHGNDACNDLTDAILEASLS
VRTPEPSLGFRYSPKINEKTRRLVFENIAQGFGFPSIKHEEKNTRQMIEHYKVPPDEAAH
WALVLCMAPGVGKRRGLQKTRTEGGGLIWIDKCCELAFYDGFDYSFANIQTGPKTGDATK
FKTFEELFAAFEKQVEFATALHYRHKDVTRRAEIKFIESPFVASLDDACMDDGVGAFVDK
TYPNPWNNTPGEQAAADSLAAVKKLVFDDKKYTMEDVVNAMKADFKGYEEMRKDMLAAPK
WGNDDPYVDEIGGRVFTMVADKLLEQTTYSGMHPLGNPQTVSTFATRAPRVGALPFGRSH
GEVLHDGGSSPYVGLDKKGPTAVLKSVAHIPFDRYKGVQFNQRLPVSVMRGDKGFQIWTA
YMKAWHDLNIDHVQFNVVDTKDMIEAQKEPEKWQSLIVRIAGYSARFVSLPKNAQDAIIA
RTEQPLS
Comment
Incomplete sequence.
Reference
  Authors
Selesi D, Jehmlich N, von Bergen M, Schmidt F, Rattei T, Tischler P, Lueders T, Meckenstock RU
  Title
Combined genomic and proteomic approaches identify gene clusters involved in anaerobic 2-methylnaphthalene degradation in the sulfate-reducing enrichment culture N47.
  Journal
J Bacteriol 192:295-306 (2010)
DOI:10.1128/JB.00874-09

DBGET integrated database retrieval system