KEGG   Addendum: ADB04298
Entry
ADB04298          CDS       T10000                                 

Gene name
nmsC
Definition
(KEGG) naphthyl-2-methylsuccinate synthase gamma subunit
  KO
K15568  naphthyl-2-methylsuccinate synthase gamma subunit [EC:4.1.99.-]
Taxonomy
TAX:700510
  Lineage
Bacteria; environmental samples
Organism
ag  Addendum (bacterium enrichment culture clone N47)
SSDB
Motif
Pfam: BssC_TutF
Other DBs
NCBI-ProteinID: ADB04298
GB: GU080101
UniProt: D2XBH9
LinkDB
AA seq 58 aa
MAECKECRFFFAVPEHADDFKPGKGDCVNERRDERGKYWLSKPVFENSETCESFVKKV
Comment
Incomplete sequence.
Reference
  Authors
Selesi D, Jehmlich N, von Bergen M, Schmidt F, Rattei T, Tischler P, Lueders T, Meckenstock RU
  Title
Combined genomic and proteomic approaches identify gene clusters involved in anaerobic 2-methylnaphthalene degradation in the sulfate-reducing enrichment culture N47.
  Journal
J Bacteriol 192:295-306 (2010)
DOI:10.1128/JB.00874-09

DBGET integrated database retrieval system