KEGG   Addendum: ADB04303
Entry
ADB04303          CDS       T10000                                 

Gene name
bnsH
Definition
(KEGG) naphthyl-2-hydroxymethylsuccinyl-CoA hydratase
  KO
K15572  naphthyl-2-hydroxymethylsuccinyl-CoA hydratase [EC:4.2.1.-]
Taxonomy
TAX:700510
  Lineage
Bacteria; environmental samples
Organism
ag  Addendum (bacterium enrichment culture clone N47)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ADB04303
GB: GU080106
UniProt: D2XBI4
LinkDB
AA seq 267 aa
MKTYEARRSKQMGVDFIKENHVAYVTLNRPEAMNSLDPESVQRLAEIWSEVKKDNDIRVS
VFTGTGEKSFCTGTDMKKTPPPEECMAAMWLRDGQPIIPDMKMWKPIICAINGYAIGGGL
EMALACDMRIASSKAKFGFTEVKVASLAGLNGTQCLPRAIPQAVAMKMLLTGELIDAEEA
LRVGLISDIVEPAGLQELAKKYAEKIAANAPLSVKAAKQAVVMGLEMPLDQGIAFSHLLW
GVLRDTEDRKEGFRAFAEKRSPQWKGK
Comment
Incomplete sequence.
Reference
  Authors
Selesi D, Jehmlich N, von Bergen M, Schmidt F, Rattei T, Tischler P, Lueders T, Meckenstock RU
  Title
Combined genomic and proteomic approaches identify gene clusters involved in anaerobic 2-methylnaphthalene degradation in the sulfate-reducing enrichment culture N47.
  Journal
J Bacteriol 192:295-306 (2010)
DOI:10.1128/JB.00874-09

DBGET integrated database retrieval system